SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000002346 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSNLEP00000002346
Domain Number - Region: 58-83
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0704
Family EGF-type module 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000002346   Gene: ENSNLEG00000001966   Transcript: ENSNLET00000002473
Sequence length 95
Comment pep:known_by_projection supercontig:Nleu1.0:GL397298.1:314829:483414:1 gene:ENSNLEG00000001966 transcript:ENSNLET00000002473 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PEGGTCEVIAAHRCCNKNRIEERSQTVKCSCLPGKVAGTTRNRPSCVDASIVIGKWWCEM
EPCLEGEECKTLPDNSGWMCATGNKIKTTRMHPRH
Download sequence
Identical sequences ENSNLEP00000002346 ENSNLEP00000002346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]