SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000002401 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000002401
Domain Number 1 Region: 125-263
Classification Level Classification E-value
Superfamily Growth factor receptor domain 3.3e-19
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 2 Region: 493-561
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000167
Family VWC domain 0.022
Further Details:      
 
Domain Number 3 Region: 384-441
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000126
Family VWC domain 0.037
Further Details:      
 
Domain Number 4 Region: 567-625
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000199
Family VWC domain 0.011
Further Details:      
 
Domain Number 5 Region: 435-495
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000101
Family VWC domain 0.03
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000002401
Domain Number - Region: 628-687
Classification Level Classification E-value
Superfamily FnI-like domain 0.00136
Family VWC domain 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000002401   Gene: ENSNLEG00000002022   Transcript: ENSNLET00000002530
Sequence length 956
Comment pep:known_by_projection supercontig:Nleu1.0:GL397360.1:108433:153402:-1 gene:ENSNLEG00000002022 transcript:ENSNLET00000002530 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWAGLLLRAACVALLLPGAPARGYTGRKPPGHFAAERRRLGPHVCLSGFGSGCCPGWAPS
MGGGHCTLPLCSFGCGSGICIAPNVCSCQDGEQGATCPETHGPCGEYGCDLTCNHGGCQE
VARVCPVGFSMTETAVGIRCTDIDECVSSSCEGHCVNTEGGFVCECGPGMQLSADRHSCQ
DTDECLGTPCQQRCKNSIGSYKCSCRTGFHLHGNRHSCVDVNECRRPLERRVCHHSCHNT
VGSFLCTCRPGFRLRADRVSCEAFPKAVLAPSAILQPRQHPSKMLLLLPEAGRPALSPGH
SPPSGDPGPPAGVRTTRLPSPTPRLPTSSPSAPVWLLSTLMATPVPTSSLLGNLRPPSLL
QGEVMGTPSSPRGPEAPWLAAGPSPCWHVGAMHESGSRWTEPGCSQCWCEDGKVTCEKVR
CEAACSHPIPSKDRGCCPSCTGCFHSGVVRAEGDVFSPPNENCTVCVCLAGNVSCISPEC
PPGPCQTPPQSDCCTCVPVRCYFHGRWYADGAVFSGGGDECTTCVCQNGEVECSFMPCPE
LACPREEWRLGPGQCCFTCQEPTPATGCSLDDNGVEFPIGQIWSPGDPCELCICQADGSV
SCKRTDCVDSCPHPIRIPGQCCPDCSAGCTYTGRIFYNNETFPSVLDPCLSCICLPCSVT
QAPRLECTILLCQAPNSWDYRCMPPCLANFFDKRLANFFIFIFLETSCMPCMSWPVLTRC
AEVPLRTELGCPCHCASHFALLSLDSLSPLEEKQGLSAHRNVAFSKAARSLRGDTEAPAN
CSSCPGSPTASPSRPVLHLLQLLLRTNLTKMQTLPTSLAEAHGPHSPTLGPTVTFPGEPG
ASPRLSPGPSTPLGAPTLPLASPGASQPPPVTPERSFSASGAQIVSRWPPLPATLLTEAS
ALSMMDPSPSKTPITLLGPRTLSPTTSRLSTALAATTHPGPQQPPVGTSQGQESTM
Download sequence
Identical sequences ENSNLEP00000002401 ENSNLEP00000002401

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]