SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000002413 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000002413
Domain Number 1 Region: 273-341
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000259
Family RING finger domain, C3HC4 0.025
Further Details:      
 
Domain Number 2 Region: 57-80
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000000837
Family CCCH zinc finger 0.0044
Further Details:      
 
Domain Number 3 Region: 88-109
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000366
Family CCCH zinc finger 0.0048
Further Details:      
 
Domain Number 4 Region: 208-233
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000033
Family CCCH zinc finger 0.0033
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000002413
Domain Number - Region: 365-394
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00157
Family CCCH zinc finger 0.0045
Further Details:      
 
Domain Number - Region: 153-240
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 0.0458
Family Transhydrogenase domain III (dIII) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000002413   Gene: ENSNLEG00000001921   Transcript: ENSNLET00000002542
Sequence length 482
Comment pep:known_by_projection supercontig:Nleu1.0:GL397332.1:758945:808134:-1 gene:ENSNLEG00000001921 transcript:ENSNLET00000002542 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEAAAPGTTATTSGAGAAAAAAAGASPTPIPTVTAPSLGAGGGGGGSDGSGGGWTKQVT
CRYFMHGVCKEGDNCRYSHDLSDSPCSVVCKYFQRGYCIYGDRCRYEHSKPLKQEEAAAT
ELTTKSSLAASSSLSSIAGPLVEMNTGEAESRNSNFATVGAGSEDWVNAIEFVPGQPYCG
RTAPSCTEAPLQGSVTKEESEKEQTAVETKKQLCPYAAVGECRYGENCVYLHGDSCDMCG
LQVLHPMDAAQRSQHIKSCIEAHEKDMELSFAVQRSKDMVCGICMEVVYEKANPSERRFG
ILSNCNHTYCLKCIRKWRSAKQFESKIIKSCPECRITSNFVIPSEYWVEEKEEKQKLILK
YKEAMSNKACRYFDEGRGSCPFGGNCFYKHAYPDGRREEPQRQKVGTSSRYRAQRRNHFW
ELIEERENSNPFDNDEEEVVTFELGEMLLMLLAAGGDDELTDSEDEWDLFHDELEDFYDL
DL
Download sequence
Identical sequences G1QN97
ENSNLEP00000002413 XP_003270859.1.23891 ENSNLEP00000002413

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]