SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000002420 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000002420
Domain Number 1 Region: 59-80,167-244,286-377
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000000000647
Family FAD/NAD-linked reductases, N-terminal and central domains 0.067
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000002420
Domain Number - Region: 55-95,291-360,414-525
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0103
Family FAD/NAD-linked reductases, N-terminal and central domains 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000002420   Gene: ENSNLEG00000002024   Transcript: ENSNLET00000002549
Sequence length 548
Comment pep:known_by_projection supercontig:Nleu1.0:GL397315.1:4047883:4073538:1 gene:ENSNLEG00000002024 transcript:ENSNLET00000002549 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PVWCCRCSLAGHFRNYSDTETEGEIFNSLVQYFGDNLGRKVKAMPLVEETSLLEDSSVTF
PVVIIGNGPSGICLSYMLSGYRPYLSSETIHPNTILNSKLEEARHLSIVDQDLEYLSEGL
EGRSSNPVAVLFDTLLHPDADFGYDYPSVLHWKLEQHHYIPHLVLGKGPPGGAWHNMEGS
MLTISFGSWMELPGLKFKDWVSSKRRNLKGDRVMPEEVARYYKHYVKVMGLQKNFRENTY
ITSVSRLYRDQDDDDSQDRDISTKHLQIEKSNFIKRNWEIRGYQRIADGSHVPFCLFAEN
VALATGTLDSPAHLEIEGEDFPFVFHSMPEFGAAINKGKLRGKVDPVLIVGSGLTAADAV
LCAYNSNIPVIHVFRRRVTDPSLIFKQLPKKLYPEYHKVYHMMCTQSYSVDSNLLSDYTS
FPEHHVLSFKSDMKCVLQSVSGLKKIFKLSAAVVLIGSHPNLSFLKDQGCYLGHKSSQPI
TCKGNPVEIDTYTYECIKEANLFALGPLVGDNFVRFLKGGALGVTRCLATRQKKKQHLFV
ERGGDGIA
Download sequence
Identical sequences ENSNLEP00000002420 ENSNLEP00000002420

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]