SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000002426 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000002426
Domain Number 1 Region: 124-454
Classification Level Classification E-value
Superfamily Subtilisin-like 5.24e-91
Family Subtilases 0.000000000969
Further Details:      
 
Domain Number 2 Region: 453-603
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.68e-43
Family Proprotein convertase P-domain 0.0000886
Further Details:      
 
Domain Number 3 Region: 1468-1624
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.57e-31
Family Growth factor receptor domain 0.0005
Further Details:      
 
Domain Number 4 Region: 1366-1529
Classification Level Classification E-value
Superfamily Growth factor receptor domain 5.03e-31
Family Growth factor receptor domain 0.00065
Further Details:      
 
Domain Number 5 Region: 833-996
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.67e-30
Family Growth factor receptor domain 0.00067
Further Details:      
 
Domain Number 6 Region: 634-793
Classification Level Classification E-value
Superfamily Growth factor receptor domain 4.13e-29
Family Growth factor receptor domain 0.00017
Further Details:      
 
Domain Number 7 Region: 1127-1289
Classification Level Classification E-value
Superfamily Growth factor receptor domain 9.1e-28
Family Growth factor receptor domain 0.00055
Further Details:      
 
Domain Number 8 Region: 982-1140
Classification Level Classification E-value
Superfamily Growth factor receptor domain 3.14e-27
Family Growth factor receptor domain 0.00097
Further Details:      
 
Domain Number 9 Region: 35-107
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 6.97e-24
Family Prohormone convertase 1 pro-domain 0.0022
Further Details:      
 
Domain Number 10 Region: 1566-1727
Classification Level Classification E-value
Superfamily Growth factor receptor domain 7.73e-21
Family Growth factor receptor domain 0.00031
Further Details:      
 
Domain Number 11 Region: 1280-1381
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.83e-17
Family Growth factor receptor domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000002426   Gene: ENSNLEG00000001931   Transcript: ENSNLET00000002556
Sequence length 1860
Comment pep:known_by_projection supercontig:Nleu1.0:GL397309.1:7071117:7556792:1 gene:ENSNLEG00000001931 transcript:ENSNLET00000002556 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGWGSRCCCPGRLDLFCVLALLGGCLLPVCRTRVYTNHWAVKIAGGFPEANRIASKYGFI
NIGQIGALKDYYHFYHSRTIKRSVISSRGTHSFISMEPKVEWIQQQVVKKRTKRDYDFSR
AQSTYFNDPKWPSMWYMHCSDNTHPCQSDMNIEGAWKRGYTGKNIVVTILDDGIERTHPD
LMQNYDALASCDVNGNDLDPMPRYDASNENKHGTRCAGEVAAAANNSHCTVGIAFNAKIG
GVRMLDGDVTDMVEAKSVSFNPQHVHIYSASWGPDDDGKTVDGPAPLTRQAFENGVRMGR
RGLGSVFVWASGNGGRSKDHCSCDGYTNSIYTISISSTAESGKKPWYLEECSSTLATTYS
SGESYDKKIITTDLRQRCTDNHTGTSASAPMAAGIIALALEANPFLTWRDVQHVIVRTSR
AGHLNANDWKTNAAGFKVSHLYGFGLMDAEAMVMEAEKWTTVPRQHVCVESTDRQIKTIR
PNSAVRSIYKASGCSDNPNRHVNYLEHVVVRITITHPRRGDLAIYLTSPSGTRSQLLANR
LFDHSMEGFKNWEFMTIHCWGERAAGDWVLEVYDTPSQLRNFKTPGKLKEWSLVLYGTSV
QPYSPTNEFPKVERFRYSRVEDPTDDYGTEDYAGPCDPECSEVGCDGPGPDHCNDCLHYY
YKLKNNTRICVSSCPPGHYHADKKRCRKCAPNCESCFGSHGDQCMSCKYGYFLNEETNSC
VTHCPDGSYQDTKKNLCRKCSENCKTCTEFHNCTECRDGLSLQGSRCSVSCEDGRYFNGQ
DCQPCHRFCATCAGAGADGCINCTEGYFMEDGRCVQSCSISYYFDHSSENGYKSCKKCDI
SCLTCNGPGFKNCTSCPSGYLLDLGMCQMGAICKDGEYVDEHGHCQTCEASCAKCQGPTQ
EDCTTCPMTRIFDDGRCVSNCPSWKFEFENQCHPCHHTCQRCQGSGPTHCTSCGADNYGR
EHFLYQGECQDSCPEGHYATEGNTCLPCPDNCELCHSVHVCTRCMKGYFIAPTNHTCRKL
ECGQGEVQDPDYEECVPCEEGCLGCSLDDPGTCTSCAMGYYRFDHHCYKTCPEKTYSEEV
ECKTCDSNCGSCDQNGCYWCEEGFFLLGGSCVRKCSPGFYGDQELGECEPCHQACETCTG
PAHDQCSSCREGLQLLRGVCVHATQTQEEGKFWNDILRKSQPCHSSCKTCNGSATLCTSC
PKGAYLLAQACVSSCPQGTWPSIRSGSCENCTEACAICSGADLCKKCKMQPGHPLFLHEG
RCYSKCPEGFYAEDGICERCSSPCRTCEGNATNCHSCEGGLVLHHRVCQETCPERHVAVE
GVCKHCPEMCQDCIHEKTCKECMSEFFLHDDMCHQSCPRGFYADSRHCVPCHKDCLECSG
PKADDCELCSENSWVLYDGLCLEECPAGTYYEKETKECRDCHKSCLTCSSSGTCTACQKG
LMMNPRGSCTANKKCTPSEYWDEDAARCKPCHAKCFHCMGPAEDQCQTCPRNSLLLNTTC
VKDCPEGYYADEDSHRCARCHSSCRTCEGRHSRQCHSCRPGWFQLGKECLLQCREGYYAD
NSTGRCERCNRSCKGCQGPRPTDCLSCDRFFFLFRSKGECHRSCPDHYYVEQSTQTCERC
HPTCDQCKGKGALNCLSCVWSYHLMGGICTSDCLVGEYRVGEGEKFNCEKCHESCMECKG
PGAKNCTLCPANLVLHTDDSRCLHCCNTSDPPSAQECCDCQDTTDECILRTSKVRPAAEH
FKTALFITSSVMLALLLGGAVVVWKKSHGRVQPVAKAGYEKLADPNKSYSSYKSSYREST
SFEEDQVIEYRDRDYDEDDDDDIVYMGQDGTVYRKFKYGLLDDDDIDELEYDDESYSYYQ
Download sequence
Identical sequences G1QNB0
XP_003267477.1.23891 ENSNLEP00000002426

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]