SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000002447 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000002447
Domain Number 1 Region: 533-709
Classification Level Classification E-value
Superfamily gamma-Crystallin-like 3.76e-49
Family Crystallins/Ca-binding development proteins 0.00012
Further Details:      
 
Domain Number 2 Region: 722-886
Classification Level Classification E-value
Superfamily gamma-Crystallin-like 1.15e-44
Family Crystallins/Ca-binding development proteins 0.00088
Further Details:      
 
Domain Number 3 Region: 363-505
Classification Level Classification E-value
Superfamily gamma-Crystallin-like 4.92e-29
Family Crystallins/Ca-binding development proteins 0.0014
Further Details:      
 
Domain Number 4 Region: 892-1021
Classification Level Classification E-value
Superfamily Ricin B-like lectins 1.24e-24
Family Ricin B-like 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000002447   Gene: ENSNLEG00000002042   Transcript: ENSNLET00000002577
Sequence length 1023
Comment pep:known_by_projection supercontig:Nleu1.0:GL397284.1:4318418:4392572:1 gene:ENSNLEG00000002042 transcript:ENSNLET00000002577 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPDFQPGDTTVRLEKRMSLTAIYDKRRETDYSGEKGYNLAFVSQDEQENSSFTILYEEPL
QEEDKYASAEARQTRSVLFRDTSPDSMPVLACERSESRTDLVHHFEKGTKLGETFDSDSS
EMFLSVEAKRYKIYPLALSPIYEDDSSQEDILSSEVSPGHHGPRKSRESENQSSSVLSLL
QSVSERLKMNFDEDDREAADEEEEEEAAVLHKGDLRAGSGEHVTFQLPDPSITFYPDDQE
SIGISKNSYVMPNEPTTSNLQVGLWPEKTSFLQKSDLTSKLHSSLKSVYHQYLQTSQSHS
SEKGARFGGIFQEPVSKYFCVQDNPGRLSPFIEVMDHEVRSSRPAWPRCKVILKSFANIF
QTKLSDNIPNFSRYCMWENFLIKVVRGCWILYEKPHFRGQKCVLEEGEKVLNSDWIPQNR
RHPQRNSILGSLKRVLKDCSIPEIELLPQSDPACCPVYIQRAVPNLEELNISKSMSFTVK
SGVWLAYPDINFKGQATVLEEDHGLFEISTAEMKSLHPLQMGGLKVEMPMNLKVIVYEKP
HFHGQAKEFSEHIDSVPNFLKNDGDFHRIGSIRVIGGVWVAYEKEHFKGQQFLLEEGDFE
DSNACGALSGPILSFRYLQANFIESSVTLFESDLESGKFIDITNQEISDLEEIGFGSKTR
SIHVKSGVWVAYQQKFFCGEQYILEKGKYKCFFDWGGSNNIIMSIRPIQLEPLGINEPPH
LLKAFSKPGFQGECIDFTEETSDLTSLMPCSFKVLRGCWLLYYQEDMFVNHCVLEEGLYA
DLTSCGCPASKVKSLKPIDYVFEEPSISLFALEHCEGRELHLEEAVNSVLNKDLHFYTQS
VWVKSGLWIAYEGSNFLGRQILLRPNEIPNWTAFSRWKTIGSLRPMKQPAVYIRIKNRAQ
DEYLTVTGNLADTRATSVCISPYSGKNTQIWHYCRGLFKSKANDTCLDVIGGRDTPGAKV
ALWTEHGQFRQKWRLNKNGTISSYLSDQLVLDVKGGNYCDKTHIIVNQPLEGEETQKWDI
EIL
Download sequence
Identical sequences ENSNLEP00000002447 ENSNLEP00000002447

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]