SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000002476 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000002476
Domain Number 1 Region: 33-132
Classification Level Classification E-value
Superfamily Fibronectin type III 4.87e-23
Family Fibronectin type III 0.0012
Further Details:      
 
Domain Number 2 Region: 340-515
Classification Level Classification E-value
Superfamily Fibronectin type III 5.13e-16
Family Fibronectin type III 0.0023
Further Details:      
 
Domain Number 3 Region: 127-229
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000746
Family Fibronectin type III 0.00095
Further Details:      
 
Domain Number 4 Region: 258-329
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000113
Family Fibronectin type III 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000002476   Gene: ENSNLEG00000001947   Transcript: ENSNLET00000002606
Sequence length 743
Comment pep:known_by_projection supercontig:Nleu1.0:GL397303.1:1024158:1084108:1 gene:ENSNLEG00000001947 transcript:ENSNLET00000002606 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSPQPSCANLGMMWTWALWMFPSLCKFSLAALPAKPENISCVYYYRKNLTCTWSPGKETS
YTQYTAKRTYAFGEKHDNCTTNSSTSENRASCSFFLPRITIPDNYTIEVEAENGDGVIKS
DMTYWRLEDIAKTEPPRIFSVKPVLGIKRMIQIEWIKPELAPVSSDLKYTLRFRTVNSTS
WMEVNFAKNRKDENQTYNLTGLQAFTEYVVALQCAVKESKFWSDWSQEKMGTTEEEAPCG
LELWRVLKPAEADGRRPVRLLWKKARGAPVLEKTLGYNIWYYPENNTNLTETMNTTNQQL
ELHLGGKSYWVSMISYNSLGKSPVATLRIPAIQEKPFQCIEVMQVCLAEDQLVVKWQSSA
LDVNTWMIEWFPDVDSEPTTLSWESVSQATNWTIQQDKLKPFWCYNISVYPMLHDKVGEP
YSIQAYAKEGVPSEGPETKVENIGVKTVTIAWKEIPKSERKGIICNYTIFYQAEGGKGFS
KTVNSSILQYSLESLQRKTSYTVQVMASTSAGGTNGTSINFKTLSFSVFEIILITSLIGG
GLLILIILTVAYGLKKPNKLTHLCWPSVPNPADSSIATWRGDDFKDKLNLKESDDSVNTG
NRILKPYSTPSDKLVIDKLVVNFGNVLQEIFTDEARMGQENNLGGEKNEYVTYPFRPDCP
LGKSFEALPVSPEIPPRKSQYLRLRMPEGTCLEAKEQLLFSGQSLVPDHLCEEGAPNPYL
KNSVTTREFLVSEKLPEHTKGEV
Download sequence
Identical sequences ENSNLEP00000002476 ENSNLEP00000002476

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]