SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000002485 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000002485
Domain Number 1 Region: 424-469
Classification Level Classification E-value
Superfamily Hormone receptor domain 0.00000379
Family Hormone receptor domain 0.0076
Further Details:      
 
Domain Number 2 Region: 767-1036
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00000778
Family Rhodopsin-like 0.033
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000002485
Domain Number - Region: 236-306
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0029
Family V set domains (antibody variable domain-like) 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000002485   Gene: ENSNLEG00000002076   Transcript: ENSNLET00000002615
Sequence length 1074
Comment pep:known_by_projection supercontig:Nleu1.0:GL397331.1:5512295:5521387:-1 gene:ENSNLEG00000002076 transcript:ENSNLET00000002615 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVCSAAPLLLLATALPLMGSPVAQASQSVSETGVSPREGLQRRQWGPLVGRDKAWNERID
RPFPACPIPLSSSFGWPRGQTMWAQTSTLTLTEEELGQSQAGGESGSVQLLDQENGAGES
ALVSVYVHLDFSDKTWPPEVSRTLTFPAASASSSPRPLLTGLRLTTECNVNHEGNFYCAC
LSGYQWNTSICLHYPPCQSHEFKLDIIQDLSCIGPRVPPPGSPVACLPAVPGILNLNSQL
QMPGDTLSLTLRLSREATNLSWFLRHPGSPSPILLQPGTQVSVTSSHGQAALSVSNMSHH
WAGEYMSCFEAQGFKWNLYEVVRVPLKATDVARLPYQLSISCATSPGFQLSCCIPSTNLA
YTAAWSPGEGSKASSFNESGFQCFVLAVQRCLMADTTYTCDLQSPGLAPLRVPISITVIQ
DGDITCPEDASVLTWNVTKAGHVAQAPCPKSKRGIVRRFCGADGVWGPVHSSCTDARLLT
LFTRAKLLQAGQGSPAEEVPQILAQLPGQAAEASSSSDLLTLLNTMKYLAKVVAKARIQL
DRSALKNLLIATDKVLDMDTRSLWTLAQARKPWAGSTLLLAVETLACSLCPQDHPFAFNL
PNVLLQSQLFGPTFPADYSISFPTQPPLQAQIPGHSLAPLVRNGTEISITSLVLRKLDHL
LPSNYGQGLGDSLYATPGLVLVISIMAGDRAFSQGEVIMDFGNTGGSPHCVFWDHSLFQG
RGGWSKEGCQARAASASPTAQCFCQHLTAFSVLMSPHTVPEEPALALLTQVGLGASILAL
LVCLGVYWLVWRVVVRNKISYFRHAALLNMVFCLLAADTCFLGAPFLPPGPQSPLCLAAT
FLCHFLYLATFFWMLAQALLLAHQLLFVFHQLPKHRVLPLMVLLGYLCPLGLAGVTLGLY
LPQGQYLREGECWLDGKGGALYTFVGPVLAIIGVNGLVLAMAMLKLLRPSLSEGPPAEKR
QALLAVIKALLVLTPIFGLTWGLGLATLLEEVSTVPHYFFTILNTLQGVFILLFGCLMDR
KVQEALRKHFCRAQAPNSTISLVSCWLQILSCPSESMSEGIPWPSSEDMGTARS
Download sequence
Identical sequences ENSNLEP00000002485 ENSNLEP00000002485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]