SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000002497 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000002497
Domain Number 1 Region: 20-136
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000138
Family V set domains (antibody variable domain-like) 0.014
Further Details:      
 
Domain Number 2 Region: 149-228
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000102
Family C1 set domains (antibody constant domain-like) 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000002497   Gene: ENSNLEG00000002061   Transcript: ENSNLET00000002628
Sequence length 302
Comment pep:novel supercontig:Nleu1.0:GL397412.1:915854:932891:-1 gene:ENSNLEG00000002061 transcript:ENSNLET00000002628 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLGSPGLLFLLFSSLRADTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESK
TVVTYHIPQNSSLENVDSRYRNRALMSPAGMRRGDFSLRLFNVTPQDEQKFHCLVLSQSL
GFQEVLSVVVTLHVAANFSVPVVSAPNGPSQDELTFTCTSINGYPRPNVYWINKTDNSLL
DQALQNDTVFLNTRGLYDVVSVLRIAWTPSVNIGCCIENVLLQQNLTVGSQTGNEIGERD
KITENPVSTGEKHVATWSILAVPCLLVAVAVAIFLVLRGRWLQGSYAGVWAVRPEPELTG
HV
Download sequence
Identical sequences A0A2I3H0B8
XP_003277412.1.23891 ENSNLEP00000002497

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]