SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000002507 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000002507
Domain Number 1 Region: 164-502
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.33e-65
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.00066
Further Details:      
 
Domain Number 2 Region: 52-146
Classification Level Classification E-value
Superfamily RING/U-box 4.24e-22
Family Zf-UBP 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000002507   Gene: ENSNLEG00000002008   Transcript: ENSNLET00000002639
Sequence length 513
Comment pep:known_by_projection supercontig:Nleu1.0:GL397319.1:12910100:12957011:1 gene:ENSNLEG00000002008 transcript:ENSNLET00000002639 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGGASLRRRTFCSLHWPTLALSIGFPFSKPVMIFPSAKNGRVDSEDRRSRHCPYLDTIN
RSVLDFDFEKLCSISLSHINAYACLVCGKYFQGRGLKSHAYIHSVQFSHHVFLNLHTLKF
YCLPDNYEIIDSSLEDITYVLKPTFTKQQIANLDKQAKLSRAYDGTTYLPGIVGLNNIKA
NDYANAVLQALSNVPPLRNYFLEEDNYKNIKRPPGDIMFLLVQRFGELMRKLWNPRNFKA
HVSPHEMLQAVVLCSKKTFQITKQGDGVDFLSWFLNALHSALGGTKKKKKTIVTDVFQGS
MRIFTKKLPHPDLPAEEKEQLLHNDEYQETMVESTFMYLTLDLPTAPLYKDEKEQLIIPQ
VPLFNILAKFNGITEKEYKTYKENFLKRFQLTKLPPYLIFCIKRFTKNNFFVEKNPTIVN
FPITNVDLREYLSEEVQAVHKNTTYDLIANIVHDGKPSEGSYRIHVLHHGTGKWYELQDL
QVTDILPQMITLSEAYIQIWKRRDNDETNQQGA
Download sequence
Identical sequences ENSNLEP00000002507

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]