SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000002521 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000002521
Domain Number 1 Region: 21-137
Classification Level Classification E-value
Superfamily Immunoglobulin 6.09e-25
Family V set domains (antibody variable domain-like) 0.000000982
Further Details:      
 
Domain Number 2 Region: 154-230
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000431
Family I set domains 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000002521   Gene: ENSNLEG00000002063   Transcript: ENSNLET00000002653
Sequence length 365
Comment pep:known_by_projection supercontig:Nleu1.0:GL397293.1:3709939:3767260:1 gene:ENSNLEG00000002063 transcript:ENSNLET00000002653 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFLLRFVLLYGVVDFARSLSITTPEEMIEKAKGETAYLPCKFTLSPEDQGPLDIEWLIS
PADNQKVDQVIILYSGDKIYDDYYPDLKGRVHFTSNDLKSGDASINVTNLQLSDIGTYQC
KVKKAPGVANKKIHLVVLVKPSGARCYVDGSEEIGSDFKLKCEPKEGSLPLQYEWQKLSD
SQKMPTSWLAEMTSSVISVKNASSEYSGTYSCTVRNRVGSDQCLLRLNVVPPSNKAGLIA
GAIIGTLLALALIGLIIFCCRKKRREEKYEKEVHHDIREDVPPPKSRTSTARSYIGSNHS
SLGSMSPSNMEGYSKTQYNQVPSEDFERTPQSPTLPPAKVAAPNLSRMGAIPVMIPAQSK
DGSIV
Download sequence
Identical sequences G1QNK5
ENSNLEP00000002521 XP_012357356.1.23891 ENSNLEP00000002521

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]