SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000002545 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000002545
Domain Number 1 Region: 1017-1231
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.22e-107
Family Thrombospondin C-terminal domain 0.00000000116
Further Details:      
 
Domain Number 2 Region: 91-295
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.85e-39
Family Laminin G-like module 0.00000000463
Further Details:      
 
Domain Number 3 Region: 894-1015
Classification Level Classification E-value
Superfamily TSP type-3 repeat 7.32e-37
Family TSP type-3 repeat 0.000000129
Further Details:      
 
Domain Number 4 Region: 551-608
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 2.62e-17
Family TSP-1 type 1 repeat 0.0000131
Further Details:      
 
Domain Number 5 Region: 497-546
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 4.05e-16
Family TSP-1 type 1 repeat 0.0000342
Further Details:      
 
Domain Number 6 Region: 825-896
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.0000000000000379
Family TSP type-3 repeat 0.00022
Further Details:      
 
Domain Number 7 Region: 379-436
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000335
Family VWC domain 0.0079
Further Details:      
 
Domain Number 8 Region: 753-837
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.0000000000051
Family TSP type-3 repeat 0.00014
Further Details:      
 
Domain Number 9 Region: 441-490
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000144
Family TSP-1 type 1 repeat 0.0008
Further Details:      
 
Domain Number 10 Region: 609-661
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000429
Family EGF-type module 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000002545   Gene: ENSNLEG00000001916   Transcript: ENSNLET00000002678
Sequence length 1232
Comment pep:known_by_projection supercontig:Nleu1.0:GL397306.1:407929:424297:1 gene:ENSNLEG00000001916 transcript:ENSNLET00000002678 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PLRPSWPASSGFLPLSRSNLYSGRTGSPRAPPALAALATLATAPGRRAPVHTGSLLGTNS
STMGLAWGLGILFLMHVCGTNRIPESGGDNSVFDIFELTGAARKGSGRRLVKGPDPSSPA
FRIEDANLIPPVPDDKFQDLVDAVRAEKGFLLLASLRQMKKTRGTLLALERKDHSGQVFS
VVSNGKAGTLDLSLTVQGKQHVVSVEEALLATGQWKSITLFVQEDRAQLYIDCEKMENAE
LDVPIQSVFTRDLASIARLRIAKGGVNDNFQGVLQNVRFVFGTTPEDILRNKGCSSSTSV
LLTLDNNVVNGSSPAIRTNYIGHKTKDLQAICGISCDELSSMVLELRGLRTIVTTLQDSI
RKVTEENKELANELRRPPLCYHNGVQYRNNEEWTVDSCTECRCQNSVTICKKVSCPIMPC
SNATVPDGECCPRCWPSDSADDGWSPWSEWTSCSTSCGNGIQQRGRSCDSLNNRCEGSSV
QTRTCHIQECDKRFKQDGGWSHWSPWSSCSVTCGDGVITRIRLCNSPSPQMNGKPCEGEA
RETKACKKDACPINGGWGPWSPWDICSVTCGGGVQKRSRLCNNPTPQFGGKDCVGDVTEN
QICNKQDCPIDGCLSNPCFAGVKCTSYPDGSWKCGACPPGYSGNGIQCTDVDECKEVPDA
CFIHNGEHRCKNTDPGYNCLPCPPRFTGSQPFGQGVEYATANKQVCKPRNPCTDGTHDCN
KNAKCNYLGHYSDPMYRCECKPGYAGNGIICGEDTDLDGWPNENLVCVANATYHCKKDNC
PNLPNSGQEDYDKDGIGDACDDDDDNDKIPDDRDNCPFHYNPAQYDYDRDDVGDRCDNCP
YNHNPDQADTDNNGEGDACAADIDGDGILNERDNCQYVYNVDQRDTDMDGVGDQCDNCPL
EHNPDQLDSDSDRIGDTCDNNQDIDEDGHQNNLDNCPYVPNANQADHDKDGKGDACDHDD
DNDGIPDDRDNCRLVPNPDQKDSDGDGRGDACKDDFDHDSVPDIDDICPENVDISETDFR
RFQMIPLDPKGTSQNDPNWVVRHQGKELVQTVNCDPGLAVGFDEFNAVDFSGTFFINTER
DDDYAGFVFGYQSSSRFYVVMWKQVTQSYWDTNPTRAQGYSGLSVKVVNSTTGPGEHLRN
ALWHTGNTPGQVRTLWHDPRHIGWKDFTAYRWRLSHRPKTGFIRVVMYEGKKIMADSGPI
YDKTYAGGRLGLFVFSQEMVFFSDLKYECRDP
Download sequence
Identical sequences ENSNLEP00000002545

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]