SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000002639 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000002639
Domain Number 1 Region: 122-287
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 4.45e-50
Family CRAL/TRIO domain 0.0000285
Further Details:      
 
Domain Number 2 Region: 23-102
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 4.19e-18
Family CRAL/TRIO N-terminal domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000002639   Gene: ENSNLEG00000002146   Transcript: ENSNLET00000002781
Sequence length 354
Comment pep:known_by_projection supercontig:Nleu1.0:GL397267.1:11261471:11479431:1 gene:ENSNLEG00000002146 transcript:ENSNLET00000002781 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPVSLLPKYQKVSTWNGDLAKMTHLQAGLSPETIEKARLELNENPDVLHQDIQQVRDMI
ITRPDIGFLRTDDAFILRFLRARKFHQADAFRLLAQYFQYRQLNLDMFKNFKADDPGIKR
ALIDGFPGVLENRDHYGRKILLLFAANWDQSRNSFTDILRAILLSLEVLIEDPELQINGF
ILIIDWSNFSFKQASKLTPSILKLAIEGLQDSFPARFGGVHFVNQPWYIHALYTLIKPFL
KDKTRKRIFLHGNNLNSLHQLIHPEFLPSEFGGTLPPYDMGTWARTLLGPDYSDENDYTH
TSYNAMHVKHTSSNLERECSPKLMKRSQSVVEAGTLKHEEKGENENTQPLLALD
Download sequence
Identical sequences G1QNX3
XP_012363653.1.23891 XP_012363656.1.23891 ENSNLEP00000002639 ENSNLEP00000002639

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]