SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000002654 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000002654
Domain Number 1 Region: 339-725
Classification Level Classification E-value
Superfamily Phosphofructokinase 1.57e-106
Family Phosphofructokinase 0.00000893
Further Details:      
 
Domain Number 2 Region: 8-360
Classification Level Classification E-value
Superfamily Phosphofructokinase 7.59e-106
Family Phosphofructokinase 0.000000279
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000002654   Gene: ENSNLEG00000002171   Transcript: ENSNLET00000002796
Sequence length 731
Comment pep:known_by_projection supercontig:Nleu1.0:GL397412.1:984758:1010625:1 gene:ENSNLEG00000002171 transcript:ENSNLET00000002796 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAVDLEKLRASGAGKAIGVLSSGGDAQGMNAAVRAVTRMGIYVGAKVFLIYEGYEGLVE
GGENIKQANWLSVSNIIQLGGTIIGSARCKATTREGRRAAAYNLVQHGITNLCVIGGDGS
LTGANIFRSEWGSLLEELVAEGKISETAARTYSHLNIAGLVGSIDNDFCGTDMTIGTDSA
LHRIMEVIDAITTTAQSHQRTFVLEVMGRHCGYLALVSALASGADWLFIPEAPPEDGWEN
FMCERLGETRSLGSRLNIIIIAEGAIDRNGKPISSSYVKDLVVQRLGFDTRVTVLGHVQR
GGTPSAFDRVLSSKMGMEAVMALLEATPDTPACVVTLSGNQSVRLPLMECVQMTKEVQKA
MDDKRFDEAIQLRGGSFENNWNIYKLLAHQKPPKEKSNFSLAILNVGAPAAGMNAAVRSA
VRTGISHGHTVYVVHDGFEGLAKGQVQEVGWYNVAGWLGRGGSMLGTKRTLPKGQLESIV
ENIRIHGIHALLVVGGFEAYEGVLQLVEARGRYEELCIVMCVIPATISNNVPGTDFSLGS
DTAVNAAMESCDRIKQSASGTKRRVFIVETMGGYCGYLATVTGIAVGADAAYVFEDPFNI
HDLKVNVEHMTEKMKTDIQRGLVLRNEKCHDYYTTEFLYNLYSSEGKGVFDCRTNVLGHL
QQGGAPTPFDRNYGTKLGVKAMLWLSEKLREVYRKGRVFANAPDSACVIGLKKKAVAFSP
VTELKKDTDFE
Download sequence
Identical sequences ENSNLEP00000002654 ENSNLEP00000002654

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]