SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000002681 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000002681
Domain Number 1 Region: 43-118
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000256
Family I set domains 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000002681   Gene: ENSNLEG00000002203   Transcript: ENSNLET00000002825
Sequence length 277
Comment pep:known_by_projection supercontig:Nleu1.0:GL397456.1:1827256:1841231:-1 gene:ENSNLEG00000002203 transcript:ENSNLET00000002825 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQTCPLAFPGPVSRALGALLFLAASLGAQNEGWDSPICTEGVVSVSWGENAVMSCNISNA
FSHVNIKLHAHGQESAIFNEVAPGYFSRDGWQLQVQGGMAQLVIKGARDSHAGLYMWHLV
GHQRNNRQVTLEVSGAEPQSAPDAWSWPVPAVVTAIFILLVALVMFAWYRCRCSQCREKK
FFLLEPQMKVRALRAGTQQGLSRASPDLWTPDSKPTPRPLALVFKPSAFGPLELLSPQPL
FPDATDPQPPARQRGHRRASPECRTWVAGPGPLVPPG
Download sequence
Identical sequences ENSNLEP00000002681 ENSNLEP00000002681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]