SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000002696 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000002696
Domain Number 1 Region: 37-187
Classification Level Classification E-value
Superfamily C-type lectin-like 1.31e-31
Family C-type lectin domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000002696   Gene: ENSNLEG00000002220   Transcript: ENSNLET00000002840
Sequence length 273
Comment pep:known_by_projection supercontig:Nleu1.0:GL397293.1:4459284:4486049:1 gene:ENSNLEG00000002220 transcript:ENSNLET00000002840 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRLVSLLLGAALLCGHGAFCRRVVSGQKVCFADFKHPCYKMAYFHELSSRVSFQEARLA
CESEGGVLLSLENEAEQKLIESMLQNLTKPGTGISDGDFWIGLWRNGDGQTSGACPDLYQ
WSDGSSFQYRNWYTDEPSCGSEKCVVMYHQPTANPGLGGPYLYQWNDDRCNMKHNYICKY
DPEINPTAPVEKPYLTNQPGDTHQNVVVTEAGIIPNLIYVVIPTIPLLLLILVAFGTCCF
QMLHKSKGRTKTSPNQSTLWISKSARKESGMEV
Download sequence
Identical sequences G1QP30
XP_003263840.1.23891 ENSNLEP00000002696 ENSNLEP00000002696

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]