SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000002710 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000002710
Domain Number 1 Region: 763-1017
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.57e-88
Family Eukaryotic proteases 0.000000036
Further Details:      
 
Domain Number 2 Region: 344-501
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.65e-27
Family MAM domain 0.011
Further Details:      
 
Domain Number 3 Region: 522-632
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.22e-25
Family Spermadhesin, CUB domain 0.001
Further Details:      
 
Domain Number 4 Region: 225-334
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.45e-18
Family Spermadhesin, CUB domain 0.0011
Further Details:      
 
Domain Number 5 Region: 59-164
Classification Level Classification E-value
Superfamily SEA domain 1.44e-16
Family SEA domain 0.0071
Further Details:      
 
Domain Number 6 Region: 672-773
Classification Level Classification E-value
Superfamily SRCR-like 0.0000000000000366
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0086
Further Details:      
 
Domain Number 7 Region: 639-677
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000236
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 8 Region: 183-222
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000641
Family LDL receptor-like module 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000002710   Gene: ENSNLEG00000002254   Transcript: ENSNLET00000002856
Sequence length 1018
Comment pep:known_by_projection supercontig:Nleu1.0:GL397293.1:4488576:4642740:-1 gene:ENSNLEG00000002254 transcript:ENSNLET00000002856 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSKRSVSSRHHSLSSYEIMFAALFAILVVLCAGLIAVSWLTIKESQRGAALGQSHEARG
TFKITSGVTYNPNLQDKLSVDFKVLAFDLQQMIDEIFLSSNLKNEYKNSRVLQFENGSII
VIFDLFFAQWVSDENVKEELIQGIEANKSSQLVTFHIDLNSVDILDKLTTTSHLAAPGNV
SIECLPGSSPCTDALTCIKADLFCDGEVNCPDGSDEDNKMCATVCDGRFLLTGSSGSFQA
THYPKPSETSVVCQWIIRVNQGLSIKLSFDHFNTYYTDILDIYEGVGSSKILRASIWETN
PGTIRIFSNQVTATFLIESEESDYVGFNATYTAFNSSELNNYEKINCNFEDGFCFWVQDL
NDDNEWERIQGSTFPPFTGPNFDHTFGNASGKHLSPSPATPKPRRKKKGLILMRNPNIFA
SFQTRYHMYGENVHKLSINISNDQNMEKTVFQKEGNYGDNWNYGQVTLNETVKFKVAFNA
FKKKILSDIALDDISLTYGICNGSLYPEPTLVPTPPPELPTDCGGPFELWEPNTTFSSMN
FPNSYPNLAFCVWILNAQKGENIQLHFQEFDLENINDVVEIRDGEEADSLLLAVYTGPGP
VKDVFSTTNRMTVLLITNDVLARGGFKANFTTGYHLGIPEPCKEDNFQCKNGECVPLVNL
CDGHLHCEDGSDEADCVRFFNGTMNNNGLVQFRIQSMWHTACAENWTIQISNDVCQLLGL
GSGNSSMPIFSTDGGPFVKLNTAPDGHLILTPSQQCLQDSLIRLQCNHKSCGKKLVAQDI
TPKIVGGSNAKEGAWPWLVGLYYGGRLLCGASLVSSDWLVSAAHCVYGRNLEPSKWTAIL
GLHMTSNLTSPQTVSRLIDQIVINPHYNRRRKDNDITMMHLEFKVNYTDYIQPICLPEEN
QVFPPGRNCSIAGWGTVVYQGTTANILQEADVPLLSNEKCQQQMPEYNITENMICAGYEE
GGIDSCQGDSGGPLMCQENNRWFLAGVTSFGYKCALPNRPGVYARVSRFTEWIQSFLH
Download sequence
Identical sequences ENSNLEP00000002710 ENSNLEP00000002710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]