SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000002715 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000002715
Domain Number 1 Region: 320-504
Classification Level Classification E-value
Superfamily Fibronectin type III 6.48e-34
Family Fibronectin type III 0.00027
Further Details:      
 
Domain Number 2 Region: 27-126
Classification Level Classification E-value
Superfamily Immunoglobulin 2.65e-22
Family I set domains 0.0024
Further Details:      
 
Domain Number 3 Region: 124-230
Classification Level Classification E-value
Superfamily Immunoglobulin 1.34e-18
Family I set domains 0.019
Further Details:      
 
Domain Number 4 Region: 220-316
Classification Level Classification E-value
Superfamily Immunoglobulin 1.14e-16
Family I set domains 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000002715   Gene: ENSNLEG00000002268   Transcript: ENSNLET00000002861
Sequence length 663
Comment pep:known_by_projection supercontig:Nleu1.0:GL397293.1:7423413:7640755:1 gene:ENSNLEG00000002268 transcript:ENSNLET00000002861 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTFESLKCGKNPLNDVSEGVFISIYSIFISPSVPPAISMPQKSFNATAERGEEMTFSCRA
SGSPEPAISWFRNGKLIEENEKYILKGSNTELTVRNIINSDGGPYVCRATNKAGEDEKQA
FLQVFVQPHIIQLKNETTHENGQVTLVCDAEGEPIPEITWKRAVDGFTFTEGDKSPDGRI
EVKGQHGSSSLHIKDVKLSDSGRYDCEAASRIGGHQKSMYLDIEYAPKFISNQTIYYSWE
GNPINISCDVKSNPPASIHWRRDKLVLPAKNTTNLKTYSTGRKMILEIAPTSDNDFGRYN
CTATNRIGTRFQEYILALADVPSSPYGVKIIELSQTTAKVSFNKPDSHGGVPIHHYQVDV
KEVASEIWKIVRSHGVQTMVVLSNLEPNTTYEIRVAAVNGKGQGDYSKIEIFQTLPVREP
SPPSIHGQPSSGKSFKLSITKQDDGGAPILEYIVKYRSKDKEDQWLEKKVQGNKDHIILE
HLQWTMGYEVQITAANRLGYSEPTVYEFSMPPKPNIIKDTLFNGLGLGAVIGLGVAALLL
ILVVTDVSCFFIRQCGLLMCITRRMCGKKSGSSGKSKELEEGKAAYLKDGSKEPIVEMRT
EDERITNHEDGSPVNEPNETTPLTEPEKLPLKEENGKEALNPETIEIKVSNDIIQSKEDD
SKA
Download sequence
Identical sequences ENSNLEP00000002715

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]