SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000002755 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000002755
Domain Number 1 Region: 61-265
Classification Level Classification E-value
Superfamily vWA-like 2.92e-55
Family Integrin A (or I) domain 0.00019
Further Details:      
 
Domain Number 2 Region: 312-434
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000251
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 3 Region: 269-316
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000281
Family EGF-type module 0.022
Further Details:      
 
Domain Number 4 Region: 444-482
Classification Level Classification E-value
Superfamily Chicken cartilage matrix protein 0.00000589
Family Chicken cartilage matrix protein 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000002755   Gene: ENSNLEG00000002247   Transcript: ENSNLET00000002901
Sequence length 488
Comment pep:known_by_projection supercontig:Nleu1.0:GL397383.1:3972576:3993070:-1 gene:ENSNLEG00000002247 transcript:ENSNLET00000002901 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRPAPARRLPGLLLLLWPLLLLLLPPAAPDPVAHPGFRRLGTRGPGGSPGRRPSPATPD
RAPASGASEPGRARGAGVCKSRPLDLVFIIDSSRSVRPPEFTKVKTFVSRIIDTLDIGPA
DTRVAVVNYASTVKIEFQLQAYTDKQSLRQAVGRITPLSTGTMSGLAIQTAMDEAFTVEA
GARDPSSNIPKVAIIVTDGRPQDQVNEVAARARASGIELYAVGVDRADLKSLKMMASEPL
EEHVFYVETYGVIEKLSSRFQETFCALDPCVLGTHQCQHVCISDGEGKHHCECSQGYTLN
ADKKTCSALDKCALNTHGCEHICVNDRSGSYHCECYEGYTLNEDRKTCSAQDKCALGAHG
CQHICVNDRTGSHHCECYEGYTLNADKKTCSVRDKCALGSHGCQHICVSDGVASYHCDCY
PGYTLNEDKKTCSAIEEARRLVSTEDACGCEATLAFQDKVSSYLQRLNTKLDDILEKLKV
NEYGQIHR
Download sequence
Identical sequences G1QP89
ENSNLEP00000002755 ENSNLEP00000002755 XP_003276022.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]