SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000002766 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000002766
Domain Number 1 Region: 102-157
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000317
Family V set domains (antibody variable domain-like) 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000002766   Gene: ENSNLEG00000002310   Transcript: ENSNLET00000002912
Sequence length 236
Comment pep:known_by_projection supercontig:Nleu1.0:GL397456.1:2038064:2047067:1 gene:ENSNLEG00000002310 transcript:ENSNLET00000002912 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHRRCKPELRQNFQSASGICICHWLQIRRMRSREGRAMWLPPALLLLSLSGDHSTKVHWG
LTSCASGPEDIKKKEEENWPLKKTKEGGRRPRCHMLSRSRSWEMGMRNRVPRVRESPRAG
VRDVTMEGLRRDDEGIYWCGIERTGTDLGTRVKVIVDREGAASTTASSPANSNMGVFIGS
HKRNHYMLLVFVKVPILLILVTAILWLKGSQRVPEEPGEQPEYMNFSDLLTKDMAA
Download sequence
Identical sequences ENSNLEP00000002766 ENSNLEP00000002766

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]