SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000002800 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000002800
Domain Number 1 Region: 136-313
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 6.63e-25
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.0061
Further Details:      
 
Domain Number 2 Region: 86-130
Classification Level Classification E-value
Superfamily TGS-like 0.0000719
Family TGS domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000002800   Gene: ENSNLEG00000002272   Transcript: ENSNLET00000002947
Sequence length 353
Comment pep:known_by_projection supercontig:Nleu1.0:GL397293.1:11187165:11207187:-1 gene:ENSNLEG00000002272 transcript:ENSNLET00000002947 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEALAMGSRALRLWRVAPGGGISWRFIATSPASRLSPTELTEMRNDFFNKEKARQLSLTP
RTEKIEVKHIGKTDPGTVFVMNKNISTPYSCAMHLSEWYCRKSILALVDGQPWDMYKPLT
KSCEIKFLTFKDRDPGEVNKAYWRSCAMMMGCVIERAFKDEYVVNLVRAPEVPVISGAFC
YDVVLDSKLDEWMPTKENLRSFTKDAHALIYKDLPFETLEVEAKVALEIFQHNKYKIDFI
EEKASQNSERIIKLHRIGDFIDVSEGPLIPRTSICFQYEVSAVHNLQPTQPSLIRRFQGV
SLPVHLRAHFTIWDKLLERSRKMTPFPILFLFTTQSFFTTSPESYLLHGTVSE
Download sequence
Identical sequences G1QPD4
ENSNLEP00000002800 XP_003263850.1.23891 ENSNLEP00000002800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]