SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000002830 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000002830
Domain Number 1 Region: 19-125
Classification Level Classification E-value
Superfamily Immunoglobulin 4.09e-18
Family V set domains (antibody variable domain-like) 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000002830   Gene: ENSNLEG00000002312   Transcript: ENSNLET00000002977
Sequence length 299
Comment pep:known_by_projection supercontig:Nleu1.0:GL397456.1:2083610:2103043:-1 gene:ENSNLEG00000002312 transcript:ENSNLET00000002977 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWLPWALLLLWVPGCFALSGPSTVAGPVGGSLSVQCRYEQEHETLNKYWCRPPQILRCNK
IVETKGPAGTRKGRVSIRDSPANLSFTVTLENLTEEDAGTYWCGVDTPWLRDFHDPYFQV
EVSVFPASTSMTPTSVTAAKTSTTTTAFPPVSSTMLFAVSATHGASIQKENEAVVNSQFP
LLLSLLVLLLLLLIGASLLAWRMFQKRIKAGDHSELSQNPKQAAKQSELHYTNLELLMWP
LQEKPAPPREVEVEYSTVAAPREELHYASVVFDSNTNRIAAQRPREEEPGSDYSVIRKT
Download sequence
Identical sequences G1QPG4
ENSNLEP00000002830 ENSNLEP00000002830 XP_003279296.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]