SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000002835 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000002835
Domain Number 1 Region: 34-153
Classification Level Classification E-value
Superfamily C-type lectin-like 1.43e-29
Family C-type lectin domain 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000002835   Gene: ENSNLEG00000002364   Transcript: ENSNLET00000002982
Sequence length 158
Comment pep:known_by_projection supercontig:Nleu1.0:GL397301.1:699067:718112:1 gene:ENSNLEG00000002364 transcript:ENSNLET00000002982 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTDSVIYSMLELPTATQAQNDHGPQQKSSSSRPSCSCLVAIALGLLTAVLMSVLLYQWIL
CQGSNYSTCASCPSCPDHWMKYGNHCYYFSVEKKDWNSSLEFCLARDSHLLVIMDKQEMS
LLQVFLSESFRWIGLRNNSGWRWEDGSPLNFSRISSNS
Download sequence
Identical sequences ENSNLEP00000002835 ENSNLEP00000002835

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]