SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000002861 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000002861
Domain Number 1 Region: 13-336,452-498
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.34e-62
Family FAD-linked reductases, N-terminal domain 0.0053
Further Details:      
 
Domain Number 2 Region: 316-439
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 4.78e-30
Family L-aminoacid/polyamine oxidase 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000002861   Gene: ENSNLEG00000026994   Transcript: ENSNLET00000003009
Sequence length 511
Comment pep:known_by_projection supercontig:Nleu1.0:GL397379.1:5278974:5292069:1 gene:ENSNLEG00000026994 transcript:ENSNLET00000003009 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEATGSVGEAPGGPRVLVVGGGIAGLGAAQRLCGHSAFRHLRVLEATGRAGGRIRSERSF
GGVVEVGAHWIHGPSRDNPVFQLAAEYGLLGEKELSEENQLVETGGHVGLPSVSYASSGA
RVSLQLVAEMATLFYGLIDQTREFLHAVETPVPSVGEYLKKEIGQHVAGWTEDEETRKLK
LAILNSFFNLECCVSGTHSMDLVALAPFGEYTVLPGLDCTFSKGYQGLTNCMMASLPEDT
VVFEKPVKIIHWNGSFQEAAFPGETFPVSVECEDGDRFPAHHVIITVPLGFLKEHLDTFF
DPPLPAEKAEAIRKIGFGTNNKIFLEFEEPFWEPDCQLIQLVWEDTSPLEDAAPALRDTW
FRKLIGFVVLPSFASVHVLCGFIAGVESEFMETLSDEEVLLCLTQVLRRVTGNPRLPAPK
SVLRSRWHSAPYTRGSYSYVAVGSTGGDLDLLAQPLPADGAGAQLQILFAGEATHRTFYS
TTHGALLSGWREADRLLGLWAPQVQQPRPRL
Download sequence
Identical sequences G1QPJ5
ENSNLEP00000002861 XP_003275536.1.23891 ENSNLEP00000002861

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]