SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000002903 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000002903
Domain Number 1 Region: 133-225
Classification Level Classification E-value
Superfamily Immunoglobulin 2.39e-17
Family I set domains 0.00057
Further Details:      
 
Domain Number 2 Region: 35-137
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000169
Family I set domains 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000002903   Gene: ENSNLEG00000002337   Transcript: ENSNLET00000003052
Sequence length 297
Comment pep:known_by_projection supercontig:Nleu1.0:GL397293.1:11239566:11315910:1 gene:ENSNLEG00000002337 transcript:ENSNLET00000003052 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARRSRHRLLLLVLRYLVVALGYHKAYGFSAPKDQQVVTAVEYQEAILACKTPKKTVSSR
LEWKKLGRSVSFVYYQQTLQGDFKNRAEMIDFNIRIKNVTRSDAGKYRCEVSAPSEQGQN
LEEDTVTLEVLVAPAVPSCEVPSSALSGTVVELRCQDKEGNPAPEYTWFKDGIRLLENPR
LGSQSTNSSYTMNTKTGTLQFNTVSKLDTGEYSCEARNSVGYRRCPGKRMQVDDLNISGI
IAAVVVVALVISVCGLGVCYAQRKGYFSNSTNRKSNSSSKATTMSENDFKHTKSFII
Download sequence
Identical sequences ENSNLEP00000002903 ENSNLEP00000002903

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]