SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000002928 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000002928
Domain Number 1 Region: 53-187
Classification Level Classification E-value
Superfamily C-type lectin-like 1.1e-32
Family C-type lectin domain 0.00082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000002928   Gene: ENSNLEG00000002394   Transcript: ENSNLET00000003077
Sequence length 188
Comment pep:known_by_projection supercontig:Nleu1.0:GL397332.1:2240103:2257156:-1 gene:ENSNLEG00000002394 transcript:ENSNLET00000003077 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNWHMIISGLIVVVLKVVGMTLFLLYFPQIFNKSNDGFTTTRSYGTVSQIFGSSSPSPNG
FIPTRSYGTVCPKDWEFYQERCFFLSTSESSWNESRDFCKGKGSTLAIVNTPEKLKFLQD
ITDAEKYFIGLIYHREEKRWRWINNSVFNGNVTNQNQNFNCATIGLTKTFDAASCDTSYR
RICEKNAK
Download sequence
Identical sequences G1QPR2
XP_003270880.1.23891 ENSNLEP00000002928 ENSNLEP00000002928

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]