SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000003010 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000003010
Domain Number 1 Region: 89-258
Classification Level Classification E-value
Superfamily TRAF domain-like 7.19e-39
Family SIAH, seven in absentia homolog 0.00000264
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000003010   Gene: ENSNLEG00000002491   Transcript: ENSNLET00000003163
Sequence length 269
Comment pep:known_by_projection supercontig:Nleu1.0:GL397327.1:6531952:6611827:-1 gene:ENSNLEG00000002491 transcript:ENSNLET00000003163 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLFFTQCFGAVLDLIHLRFQHYKAKRVFSAAGQLVCVVNPTHNLKYVSSRCAVTQSAPEQ
GSFHPHHLSHHHCHHRHHHHLRHHAHPHHLHHQEVGLHATPVTPCLCMCPLFSCQWEGHL
EVVVPHLRQIHRVDILQGAEIVFLATDMHLPAPADWIIMHSCLGHHFLLVLRKQERHEGH
PQFFATMMLIGTPTQADCFTYRLELNRNHRRLKWEATPRSVLECVDSVITDGDCLVLNTS
LAQLFSDNGSLAIGIAITETEVHPSEAEM
Download sequence
Identical sequences G1QPZ2
ENSNLEP00000003010 ENSNLEP00000003010 XP_012362366.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]