SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000003032 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000003032
Domain Number 1 Region: 822-953,995-1168
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.64e-76
Family Protein kinases, catalytic subunit 0.00000000169
Further Details:      
 
Domain Number 2 Region: 673-766
Classification Level Classification E-value
Superfamily Immunoglobulin 9.97e-17
Family I set domains 0.037
Further Details:      
 
Domain Number 3 Region: 236-334
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000679
Family V set domains (antibody variable domain-like) 0.061
Further Details:      
 
Domain Number 4 Region: 350-453
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000222
Family I set domains 0.03
Further Details:      
 
Domain Number 5 Region: 560-593,625-660
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000637
Family V set domains (antibody variable domain-like) 0.055
Further Details:      
 
Domain Number 6 Region: 441-555
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000477
Family I set domains 0.036
Further Details:      
 
Domain Number 7 Region: 30-116
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00005
Family I set domains 0.095
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000003032
Domain Number - Region: 129-223
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00168
Family I set domains 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000003032   Gene: ENSNLEG00000002370   Transcript: ENSNLET00000003187
Sequence length 1363
Comment pep:known_by_projection supercontig:Nleu1.0:GL397464.1:1869385:1914889:-1 gene:ENSNLEG00000002370 transcript:ENSNLET00000003187 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQRGAALCLRLWLCLGLLDGLASGYSMTPPTLNITEESHVIDTGDSLSISCRGQHPLEWA
WPGAQEAPATGDKDSEDTGVVRDCEGTDARPYCKVLLLREVHANDTGSYVCYYKYIKARI
EGTTAASSYVFVRDFEQPFINKPDTLLVNRKDAMWVPCLVSIPGLNVTLRSQSSVLWPDG
QEVVWDDRRGMRVSTPLLRDALYLQCETTWGDQDFLSNPFLVHITGNELYDIQLLPRKSL
ELLVGEKLVLNCTVWAEFNSGVTFDWDYPGKQAERGKWVPERRSQQTHTELSSILTIHNI
SQHDLGSYVCEANNGIQRFRESTEVIVHEKPFISVEWLKGPILEATAGDELVKLPVKLAA
YPPPEYQWYKDGKALSGRHSPHALVLKEVTEASTGIYTLTLWNSAAGLRRNISLELVVNV
PPQIHEKEASSPSIYSRHSRQALTCTAYGVPLPLSIQWHWRPWTPCKMFAQRSLRRRPQR
DLMPQCRDWRAVTTQDAVNPIESLDTWTEFVEGKNKTVSKLVIQNANVSAMYKCVVSNKV
GQDERLIYFYVTTIPDGFSIESKPSEELLEGQPVRLSCQADSYKYEHLRWYRLNLSTLHD
AHGNPLLLDCKNVHLFAIPLAASLEEVAPGARHATLSLSIPRVAPEHEGHYVCEVQDRRS
HDKHCHKKYLSVQALEAPRLRQNLTDLLVNVSDSLEMQCLVAGAHAPSIVWYKDERLLEE
KSGVDLADSNQKLSIQRVREEDAGRYLCSVCNAKGCVNSSASVAVEGSEDKGSMEIVILV
GTGVIAVFFWVLLLLIFCNMRRPAHADIKTGYLSIIVDPEEVPLEEQCEYLSYDASQWEF
PRERLHLGRVLGYGAFGKVVEASAFGINKGSSCDTVAVKMLKEGATASEHRALMSELKIL
IHIGNHLNVVNLLGACTKPKGPLMVIVEYCKYGNLSNFLRAKRETFSPYAEKSPEQRGRF
RAMVELARLDRKRPGSSDRVLFARFSKNEGGARRASPDQEAEDLWLSPLTMEDLVCYSFQ
VARGMEFLASRKCIHRDLAARNILLSESDVVKICDFGLARDIYKDPDYVRKGSARLPLKW
MAPESIFDKVYTTQSDVWSFGVLLWEIFSLGASPYPGVQINEEFCQRLRDGTRMRAPELA
TPAIRRIMLNCWSGDPKARPAFSELVEILGDLLQGGDLQEEEGVCMAPRGSQSSEEGSFS
QVSTMALHVAQADAEDSPPSLQRHSLAARYYNWVSFPGCLARGAQTRGSSRMKTFEEFPM
TPTTYKTSVDNQTDSGMVLASEEFEQIESRHRQESGFSCIGPGQNVDVTRTHPDSQGRRR
RPDRGARGGQVFYNSEYGELSEPSEEDHCSPAARVTFFTDNSY
Download sequence
Identical sequences G1QQ14
ENSNLEP00000003032 ENSNLEP00000003032 XP_003279615.2.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]