SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000003081 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000003081
Domain Number 1 Region: 40-64
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000772
Family CCCH zinc finger 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000003081   Gene: ENSNLEG00000002498   Transcript: ENSNLET00000003238
Sequence length 1564
Comment pep:known_by_projection supercontig:Nleu1.0:GL397327.1:6721478:6813147:-1 gene:ENSNLEG00000002498 transcript:ENSNLET00000003238 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKIRRKVTVENTKTISDSTSRRPSVFERLGPSTGSTAETQCRNWLKTGNCLYGNTCRFV
HGPSPRGKGYSSNYRRSPERPTGDLRERMKNKRQDVDTEPQKRNTEESSSPVRKESSRGR
HREKEDIKITKERTPESEEENVEWETNRDDSDNGDINYDYVHELSLEMKRQKIQRELMKL
EQENMEKREEIIIKKEVSPEVVRSKLSPSPSLRKSSKSPKRKSSPKSSSASKKDRKTSAV
SSPLLDQQRNSKTNQSKKKGPRTPSPPPPIPEDIALGKKYKEKYKVKDRIEEKTRDGKDR
GRDFERQREKRDKPRSTSPAGQHHSPISSRHHSSSSQSGSSIQRHSPSPRRKRTPSPSYQ
RTLTPPLRRSASPYPSHSLSSPQRKQSPPRHRSPMREKGRHDHERTSQSHDRRHERREDT
RGKRDRDKDSREEREYEQDQSSSRDHRDDREPRDGRDRRDARDTRDRRELRDSRDMRDSR
EMRDYSRDTKESRDPRDSRSTRDAHDYRDREGRDTHRKEDTYPEESRSYGRNHLREESSR
TEIRNESRNESRSEIRNDRMGRSRGRVPELPEKGSRGSRGSQIDSHSSNSNYHDSWETRS
SYPERDRYPERDNRDQARDSSFERRHGERDRRDNRERDQRPSSPIRHQGRNDELERDERR
EERRVDRVDDRRDERARERDRERERDRERERERERERDREREKERELERERARERERERE
KERDRERDRDRDHDRERERERERDREKEREREREERERERERERERERERERERERARER
DKERERQRDWEDKDKGRDDRREKREEIREDRNPRDGHDERKSKKRYRNEGSPSPRQSPKR
RREHSPDSDAYNSGDDKNEKHRLLSQVVRPQESRSLSPSHLTEDRQGRWKEEDRKPERKE
SSRRYEEQELKEKLSSVDKQREQTEILESSRMRAQDIIGHHQSEDRETSDRAHDENKKKA
KIQKKPIKKKKEDDVGIERGNIETTSEDGQVFSPKKGQKKKSIEKKRKKSKGDSDISDEE
AAQPTKKKRGPRTPPITTKEELVEMCNGKNGILEDSQKKEDTAFSDWSDEDVPDRTEVTE
AEHTATATTPGSTPSPLSSLLPPPPPVATATATTVPATLAATTAAAATSFSTSAITISTS
ATPPNTTNNTFASEDSHRKCHRTRVEKVETPHVTIEDAPHRKPMDQKRSSSLGSNRSNRS
HTSGRLRSPSNDSAHRSGDDQSGRKRVLHSGSRDREKTKSLEITGERKSRIDQLKRGEPS
RSTSSDRQDSRSHSSRRSSPESDRQVHSRSGSFDSRDRLQERDRYEHDRERERERRDTRQ
REWDRDADKDWPRNRDRDRLRERERERERDKRRDLDRERERLISDSVERDRDRDRDRTFE
SSQVESVKRCEAKLEGEHERDLESTSRDSVALDKERMDKDLGSVQGFEDTNKSERTESLE
AGDDESKLDDAHSLGSGAGEGYEPISDDELDEILAGDAEKREDQQDEEKMPDPLDVIDVD
WSGLMPKHPKEPREPGAALLKFTPGAVMLRVGISKKLAGSELFAKVKETCQRLLEKPKGS
FILL
Download sequence
Identical sequences G1QQ63
ENSNLEP00000003081 XP_003270103.1.23891 ENSNLEP00000003081

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]