SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000003085 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000003085
Domain Number 1 Region: 246-428
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.78e-53
Family SPRY domain 0.0000314
Further Details:      
 
Domain Number 2 Region: 20-131
Classification Level Classification E-value
Superfamily Immunoglobulin 3.6e-19
Family V set domains (antibody variable domain-like) 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000003085   Gene: ENSNLEG00000002533   Transcript: ENSNLET00000003242
Sequence length 437
Comment pep:known_by_projection supercontig:Nleu1.0:GL397464.1:2028763:2046977:1 gene:ENSNLEG00000002533 transcript:ENSNLET00000003242 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFVLILVLSFYKLVSGQWQVTGPGKFVQASVGEDAVFSCSLFPETSAEAMEVRFFRNQF
HAVVHLYRDGEDWEYMQMPQYRGRTELVKDSIARGHVSLRLKNITPLDIGLYGCWFSSQI
YDEEATWELRVAALGSVPLISIAGYVDGGIQLLCLSFFQPSPWRLASISLGLLCVALCVV
VIRMTIVFFKSKGKIQAELGMCHVLSLPHMVPSPSLIHSLSLWTTLAPGWAGSTGRWRRA
AALSELRDARKHAVEVTLDPETAHPKLCVSDLKTVTHRKAPQEVPYSKKRFTSKSVVASQ
GFQAGKHYWEVDVGQNVGWSVGVCRDDVGRWKNNVTLSPNDGYWVLGLTTERVYFTFNPH
FISLSPSTPPTRVGVFLDYEGGTISFFNINDQSCIHILTCQFEGLLRPYIKHLIYKEKMG
TPIFICPVSGSEREDPA
Download sequence
Identical sequences ENSNLEP00000003085

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]