SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000003097 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000003097
Domain Number 1 Region: 413-563
Classification Level Classification E-value
Superfamily TRAF domain-like 8.83e-47
Family MATH domain 0.000000684
Further Details:      
 
Domain Number 2 Region: 39-112
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000424
Family RING finger domain, C3HC4 0.036
Further Details:      
 
Domain Number 3 Region: 105-207
Classification Level Classification E-value
Superfamily TRAF domain-like 0.0000000000785
Family SIAH, seven in absentia homolog 0.023
Further Details:      
 
Domain Number 4 Region: 203-271
Classification Level Classification E-value
Superfamily TRAF domain-like 0.000000000118
Family SIAH, seven in absentia homolog 0.015
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000003097
Domain Number - Region: 266-308,347-402
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0462
Family ABC transporter ATPase domain-like 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000003097   Gene: ENSNLEG00000002534   Transcript: ENSNLET00000003254
Sequence length 568
Comment pep:known_by_projection supercontig:Nleu1.0:GL397352.1:5204091:5227017:1 gene:ENSNLEG00000002534 transcript:ENSNLET00000003254 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAYSEEHKGMPCGFIRQNSGNSISLDFEPNIEYQFVERLEERYKCAFCHSVLHNPHQTGC
GHRFCQHCILSLRELNTVPICPVDKEVINSQEVFKDNCCKREVLNLYVYCSNAPGCNAKV
ILGRYQQIPLACCYLLQDHLQQCLFQAVQCSNEKCREPVLRKDLKEHLSAYCQFREEKCL
YCKKDVVVINLQNHEENLCPEYPVFCPNNCAKIILKTEVDEHLAVCPEAEQDCPFKHYGC
AVTDKRRNLQEHEHSALREHMRLVLEKNVQLEEQISDLHKSLEQKESKIQQLAETIKKLE
KEFKQFAQLFGKNGSFLPNIQVFASHIDKSAWLEAQVHQLLQMVNQQQNKFDLRPLMEAV
DTVKQKITLLENNDQRLAVLEEETNKHDTHINIHKAQLSKNEERFKLLEGTCYNGKLIWK
VTDYKMKKREAVDGHTVSIFSQSFYTSHCGYRLCARAYLNGDGSGKGTHLSLYFVVMRGE
FDSLLQWPFRQRVTLMLLDQSGKKNIMETFKPDPNSSSFKRPDGEMNIASGCPRFVAHSV
LENAKNAYIKDDTLFLKVAVDLTDLEDL
Download sequence
Identical sequences ENSNLEP00000003097 ENSNLEP00000003097

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]