SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000003102 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000003102
Domain Number 1 Region: 324-509
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.35e-59
Family SPRY domain 0.0000144
Further Details:      
 
Domain Number 2 Region: 40-150
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000129
Family V set domains (antibody variable domain-like) 0.00047
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000003102
Domain Number - Region: 163-240
Classification Level Classification E-value
Superfamily Immunoglobulin 0.023
Family C1 set domains (antibody constant domain-like) 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000003102   Gene: ENSNLEG00000002564   Transcript: ENSNLET00000003259
Sequence length 539
Comment pep:known_by_projection supercontig:Nleu1.0:GL397464.1:2087940:2101629:1 gene:ENSNLEG00000002564 transcript:ENSNLET00000003259 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDFPVSLDSLKPVSLTSSLVFLMHLLLLQHGEPSSEVKVLGPDHLILAIVGEEVEFPCH
LWPQLDAQQMEIRWFRSHTSDVVHLYREQRELPGRQMQAFRNRTKLVKDDIAYGSVVLQL
HSIVPSDKGMYGCRFLSDNFSGEALWELEVARLGSDPHLSLEGFQEGGIQLRLRSSGWYP
KPKAQWRDHQGQCLPPEFEAIVWDAQGLFSLETSVVVRAGALSNVSLSIQNLLLGQKKEF
VVQIADVFLPGASPWKGAFFGTLAALPPLLLVLAALALGLLQKQRRRREKLKKQAEKRQE
KLTAELGKFWVASDWRRAEGQAEWRAAQKYAVDVTLDPASAHPSLEVSADGKSVCSRGAP
PGPAPGHPQRFSEQTCVLSLERFSAGRHYWEVHVGRRSRWFLGACLAAVPRAGSVRLSPA
TGYWVLGLWNGCEYFVLAPHRVALPLRVPPRRLGVFLDHEAGQLSFFNVSDGSHIFSFHD
TFSGALCAYFRPRAHDGGEHPDPLTICPLPVRGTSVPEGNDSDAWLQPYEPLDPALDGW
Download sequence
Identical sequences ENSNLEP00000003102 ENSNLEP00000003102

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]