SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000003134 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000003134
Domain Number 1 Region: 427-492
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.94e-22
Family SPRY domain 0.00073
Further Details:      
 
Domain Number 2 Region: 222-281
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 1.16e-17
Family B-box zinc-binding domain 0.00073
Further Details:      
 
Domain Number 3 Region: 7-52
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000872
Family RING finger domain, C3HC4 0.014
Further Details:      
 
Domain Number 4 Region: 179-211
Classification Level Classification E-value
Superfamily RING/U-box 0.000041
Family IBR domain 0.09
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000003134
Domain Number - Region: 263-385
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.0523
Family Apolipoprotein A-I 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000003134   Gene: ENSNLEG00000002598   Transcript: ENSNLET00000003293
Sequence length 493
Comment pep:known_by_projection supercontig:Nleu1.0:GL397464.1:2176642:2190042:1 gene:ENSNLEG00000002598 transcript:ENSNLET00000003293 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAVAMTPNPVQTLQEEAVCAICLDYFTDPVSIGCGHNFCRVCVTQLWGGEDEEDRDELD
REEEEEDAEEEEVEAVGPGAGWDTPMRDEDYEGDMEEEVEEEEEGVFWTSGMSRSSWDNM
DYMWEEEDEEEDLDYYLGDMEEDLRGEDEEDEEEVLEEDEEEDLDPVTPLPPPPAPRRCF
TCPQCRKSFPRRSFRPNLQLANMVQVIRQMHPTPGRGSRVTDQGICPKHQEALKLFCEVD
EEAICVVCRESRSHKQHSVVPLEEVVQEYKAKLQGHVEPLRKHLEAVQKMKAKEERRVTE
LKSQMKSELAAVASEFGRLTRFLAEEQAGLERRLREMHEAQLGRAGAAASRLAEQAAQLS
RLLAEAQERSQQGGLRLLQDIKETFNRCEEVQLQPPEVWSPDPCQPHSHDFLTDAIVRKM
SRMFCQAARVDLTLDPDTAHPALMLSPDRRGVRLAERRQEVADHPKRFLADCCVLGAQGF
RSGRHYWEVCMGP
Download sequence
Identical sequences ENSNLEP00000003134

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]