SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000003181 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000003181
Domain Number 1 Region: 2-166
Classification Level Classification E-value
Superfamily C-type lectin-like 1.18e-39
Family Endostatin 0.00000223
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000003181   Gene: ENSNLEG00000002635   Transcript: ENSNLET00000003341
Sequence length 171
Comment pep:novel supercontig:Nleu1.0:GL397412.1:2151888:2157271:1 gene:ENSNLEG00000002635 transcript:ENSNLET00000003341 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HTHRDFQPVLHLVALNSPLSGSMRGIRGADFQCFQQARVGLAGTFRAFLCSPLHRQPIGR
PSSAAPWHPQGRPPASTFPARGVASALSGAGLGLTDGPARLTPQKSVWHGSDPNGRRLTE
SYCETWRTEAPSATGQASSLLGGRLLGQNAASCHHAYIVLCIENSFMTASK
Download sequence
Identical sequences ENSNLEP00000003181 ENSNLEP00000003181

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]