SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000003203 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000003203
Domain Number 1 Region: 495-527,566-632
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000000687
Family Anti-sigma factor antagonist SpoIIaa 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000003203   Gene: ENSNLEG00000002502   Transcript: ENSNLET00000003364
Sequence length 663
Comment pep:known_by_projection supercontig:Nleu1.0:GL397315.1:5400880:5543891:1 gene:ENSNLEG00000002502 transcript:ENSNLET00000003364 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTGAKRKKKSMLWSKMHTPQCEDILQWCRRRLPILDWAPHYNLKENLLPDTVSGIMLAVQ
QVTQGLAFAVLSSVHPVFGLYGSLFPAIIYAIFGMGRHVATGTFALTSLISANAVERIVP
QNMQNLTTQSNTSVLGLSDFEMQRIRVAAAVSFLGGVIQVAMFVLQLGSATFVVTEPVIS
AMTTGAATHVVTSQVKYLLGMKMPYISGPLGFFYIYAYVFENIKSVRLEALLLSLLSIVV
LVLVKELNEQFKRKIKVVLPVDLVLIIAASFACYCTNMENTYGLEVVGHIPQGIPSPRAP
PMNILSAVITEAFGVALVGYVASLALAQGSAKKFKYSIEDNQEFLAHGLSNIVSSFFFCI
PSAAAMGRTAGLYSTGAKTQVACLISCIFVLIVIYAIGPLLYWLPMCVLASIIVVGLKGM
LIQFRDLKKYWNVDKIDWGIWVSTYVFTICFAANVGLLFGVVCTIAIVIGRFPRAMTVSI
KNMKEMEFKVKTEMDSETLQQVKIISINNPLVFLNAKKFYTDLMNIIQKENACNQPLDDI
SKCEQNTLLNSLSNGNCNEEASQSCPNEKCSLILDCSGFTFFDYSGVSMLVEVYMDCKGR
SVDVLLAHCTASLIKAMTYYGNLDSEKPIFFESVSAAISHIHSNKASYKLLFDNLDLPTM
PLL
Download sequence
Identical sequences ENSNLEP00000003203 XP_003268333.1.23891 ENSNLEP00000003203

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]