SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000003210 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000003210
Domain Number 1 Region: 23-116
Classification Level Classification E-value
Superfamily Immunoglobulin 1.43e-24
Family V set domains (antibody variable domain-like) 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000003210   Gene: ENSNLEG00000002655   Transcript: ENSNLET00000003371
Sequence length 124
Comment pep:novel supercontig:Nleu1.0:GL397332.1:2882958:2883465:1 gene:ENSNLEG00000002655 transcript:ENSNLET00000003371 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSWTFCCLSLCILVAKHTDAGVIQSPQHEVTEMGQEVTLRCKPISGHNSLFWYRQTMMQ
GLELLIYFNNNVPIDDSGMPKDRFSAKMPDVSFSILKIQPSELRDSAVYFCASSLATALQ
NHHF
Download sequence
Identical sequences ENSNLEP00000003210 ENSNLEP00000003210

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]