SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000003221 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000003221
Domain Number 1 Region: 23-116
Classification Level Classification E-value
Superfamily Immunoglobulin 7.39e-22
Family V set domains (antibody variable domain-like) 0.0000224
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000003221   Gene: ENSNLEG00000002666   Transcript: ENSNLET00000003383
Sequence length 127
Comment pep:known_by_projection supercontig:Nleu1.0:GL397332.1:2994357:3006419:1 gene:ENSNLEG00000002666 transcript:ENSNLET00000003383 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASLLLFCVAFCLLTGSVDADTTQIPRNRIAKTGKTIMLECSQTKGHDRMYWYRQDPGLG
LRLIYYSFDVNSTEKGDLSSESTVSRIRTEHFPLTLESARPSHTSQYLCASSEYTVLHGY
HSTQKGS
Download sequence
Identical sequences ENSNLEP00000003221

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]