SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000003254 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000003254
Domain Number 1 Region: 560-672
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 3.5e-23
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0019
Further Details:      
 
Domain Number 2 Region: 701-773
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 3.5e-20
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0018
Further Details:      
 
Domain Number 3 Region: 152-296
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.88e-18
Family G proteins 0.011
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000003254
Domain Number - Region: 24-117,421-470,604-626
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000392
Family Growth factor receptor domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000003254   Gene: ENSNLEG00000002632   Transcript: ENSNLET00000003417
Sequence length 777
Comment pep:known_by_projection supercontig:Nleu1.0:GL397292.1:7291710:7348843:-1 gene:ENSNLEG00000002632 transcript:ENSNLET00000003417 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAQTSPAEKGLNPGLMCQESYACSGTDEAIFECDECCSLQCLRCEEELHRQERLRNHER
IRLKPGHVPYCDLCKGLSGHLPGVRQRAIVRCQTCKINLCLECQKRTHSGGNKRRHPVTV
YNVSNLQESLEAEEMDEETKRKKMTEKVVSFLLVDENEEIQVTNEEDFIRKLDCKPDQHL
KVVSIFGNTGDGKSHTLNHTFFYGREVFKTSPTQESCTVGVWAAYDPVHKVAVIDTEGLL
GATVNLSQRTRLLLKVLAISDLVIYRTHADRLHNDLFKFLGDASEAYLKHFTKELKATTA
RCGLDVPLSTLGPAVIIFHETVHTQLLGSDHPSEVPEKLIQDRFRKLGRFPEAFSSIHYK
GTRTYNPPTDFSGLRRALEQLLENNTTRSPRHPGVIFKALKALSDRFSGEIPDDQMAHSS
FFPDEYFTCSSLCLSCGVGCKNSMNHGKEGVPHEAKSRCRYSHQYDNRVYTCKACYERGE
EVSVVPKTSASTDSPWMGLAKYAWSGYVIECPTCGVVYRSRQYWFGNQDPVDTVVRTEIV
HVWPGTDGFLKDNNNAAQRLLDGMNFMAQSVSELSLGPTKAVTSWLTDHIAPAYWRPTPR
FWSCNKCATSFKDNDTKHHCRACGEGFCDSCSSKTRPVPERGWGPAPVRVCDNCYEARNV
QLAVTEAQVDDEGGTLIARKVGEAVQNTLGAVVTAIDIPLGLVKDAARPAYWVPDHEILH
CHNCRKEFSIKLSKHHCRACGQGFCDECSHDRRAVPSRGWDHPVRVCFNCNKKPGDL
Download sequence
Identical sequences ENSNLEP00000003254 ENSNLEP00000003254

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]