SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000003260 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000003260
Domain Number 1 Region: 142-234
Classification Level Classification E-value
Superfamily Fibronectin type III 7.69e-24
Family Fibronectin type III 0.0016
Further Details:      
 
Domain Number 2 Region: 259-351
Classification Level Classification E-value
Superfamily Immunoglobulin 1.25e-20
Family I set domains 0.0053
Further Details:      
 
Domain Number 3 Region: 61-150
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000354
Family I set domains 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000003260   Gene: ENSNLEG00000002683   Transcript: ENSNLET00000003423
Sequence length 354
Comment pep:known_by_projection supercontig:Nleu1.0:GL397313.1:4642143:4658171:-1 gene:ENSNLEG00000002683 transcript:ENSNLET00000003423 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAATSPEVAAGSKLKVKEASPADAEPPQASPGQGADSPTPQLLPPIEEHPKIWLPRALR
QTYIRKVGDTVNLLIPFQGKPKPQAIWTHDGCALDTRRVSVRNGERDSILFIREAQRADS
GRYQLRVQLGGLEATATIDILVIERPGPPQSIKLVDVWGFNATLEWTPPQDTGNTALLGY
TVQKADTKSGLWFTVLEHYHRTSCIVSDLIIGNSYAFRVFAENQCGLSETAPITTDLAHI
QKAATVYKTKGFAQRDFSEAPKFTQPLADCTTVTGYNTQLFCCVRASPRPKIIWLKNKMD
IQGNPKYRALTHLGICSLEIRKPGPFDGGIYTCKAVNPLGEASVDCRVDVKVPN
Download sequence
Identical sequences G1QQP2
ENSNLEP00000003260 ENSNLEP00000003260 XP_003267938.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]