SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000003278 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000003278
Domain Number 1 Region: 16-130
Classification Level Classification E-value
Superfamily Immunoglobulin 3.23e-27
Family C1 set domains (antibody constant domain-like) 0.00000181
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000003278
Domain Number - Region: 2-22
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0818
Family V set domains (antibody variable domain-like) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000003278   Gene: ENSNLEG00000002685   Transcript: ENSNLET00000003443
Sequence length 189
Comment pep:known_by_projection supercontig:Nleu1.0:GL397332.1:3122767:3133200:1 gene:ENSNLEG00000002685 transcript:ENSNLET00000003443 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AVFGPGTRLTVLEDLRNVFPPKVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVN
GKEVHSGVSTDPQPLKEQPALNNSRYSLSSRLRVSATFWQNPRNRFRCQVQFYGLSENDE
WTQDRDKPVTQIVSAEAWGRADCGFTSESYQQGVLSATILYEILLGKATLYAVLVSALVL
MAMVKRKDS
Download sequence
Identical sequences ENSNLEP00000003278

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]