SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000003308 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000003308
Domain Number 1 Region: 309-499
Classification Level Classification E-value
Superfamily CAPPD, an extracellular domain of amyloid beta A4 protein 7.85e-83
Family CAPPD, an extracellular domain of amyloid beta A4 protein 0.0000000055
Further Details:      
 
Domain Number 2 Region: 78-142
Classification Level Classification E-value
Superfamily Amyloid beta a4 protein copper binding domain (domain 2) 2.35e-29
Family Amyloid beta a4 protein copper binding domain (domain 2) 0.00001
Further Details:      
 
Domain Number 3 Region: 21-77
Classification Level Classification E-value
Superfamily A heparin-binding domain 1.22e-25
Family A heparin-binding domain 0.0000293
Further Details:      
 
Domain Number 4 Region: 239-298
Classification Level Classification E-value
Superfamily BPTI-like 2.98e-21
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0000814
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000003308   Gene: ENSNLEG00000002530   Transcript: ENSNLET00000003474
Sequence length 704
Comment pep:known_by_projection supercontig:Nleu1.0:GL397293.1:11483890:11778011:-1 gene:ENSNLEG00000002530 transcript:ENSNLET00000003474 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRMGSGIQIHQGPKPALIQRSILQYCQEVYPELQITNVVEANQPVTIQNWCKRGRKQCK
THPHFVIPYRCLVGEFVSDALLVPDKCKFLHQERMDVCETHLHWHTVAKETCSEKSTNLH
DYGMLLPCGIDKFRGVEFVCCPLAEESDNVDSADAEEDDSDVWWGGADTDYADGSEDKVV
EVAEEEEVAEVEEEADDDEDDEDGDEVEEEAEEPYEEATERTTSIATTTTTTTESVEEVV
REVCSEQAETGPCRAMISRWYFDVTEGKCAPFFYGGCGGNRNNFDTEEYCMAVCGSVIPT
TAASTPDAVDKYLETPGDENEHAHFQKAKERLEAKHRERMSQVMREWEEAERQAKNLPKA
DKKAVIQHFQEKVESLEQEAANERQQLVETHMARVEAMLNDRRRLALENYITALQAVPPR
PRHVFNMLKKYVRAEQKDRQHTLKHFEHVRMVDPKKAAQIRSQVMTHLRVIYERMNQSLS
LLYNVPAVAEEIQDEVDELLQKEQNYSDDVLANMISEPRISYGNDALMPSLTETKTTVEL
LPVNGEFSLDDLQPWHSFGADSVPANTENEVEPVDARPAADRGLTTRPGSGLTNIKTEEI
SEVKMDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITLVMLKKK
QYTSIHHGVVEVDAAVTPEERHLSKMQQNGYENPTYKFFEQMQN
Download sequence
Identical sequences ENSNLEP00000003308

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]