SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000003317 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000003317
Domain Number 1 Region: 270-372
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000048
Family I set domains 0.034
Further Details:      
 
Domain Number 2 Region: 66-146
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000023
Family I set domains 0.053
Further Details:      
 
Domain Number 3 Region: 164-262
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000129
Family I set domains 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000003317   Gene: ENSNLEG00000002734   Transcript: ENSNLET00000003483
Sequence length 375
Comment pep:known_by_projection supercontig:Nleu1.0:GL397269.1:5241988:5309917:1 gene:ENSNLEG00000002734 transcript:ENSNLET00000003483 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKVWLLLGLLLVHEALEDVTGQHLPKNKRPKEPGENRIKPTNKKVKPKIPKIKDRDSADS
TPKTQSIMMQVLDKGRFQKPAATLSLLAGQTVELRCKGSRIGWSYPAYLDSFKDSRLSVK
QNERYGQLTLVNSTSADTGEFSCWGQLCSGYICRKDEAKTGSTYIFFTEKGELFVPSPSY
FDVVYLNPDRQAVVPCRVTVLSAKVTLHREFPAKEIPANGTDIVYDMKRGFVYLQPHSEH
QGVVYCRAEAGGRSQISIKYQLLYVTVPSGPPSTTILASSNKVKSGDDISVLCTVLGEPD
VEVEFTWIFPGQKDERPVTIQDTWRLIHRGLGHTTRISQSVITVEDFETIDAGYYICTAQ
NLQGQTTVATTVEFS
Download sequence
Identical sequences G1QQU9
ENSNLEP00000003317 XP_003256760.1.23891 ENSNLEP00000003317

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]