SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000003326 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000003326
Domain Number 1 Region: 178-280
Classification Level Classification E-value
Superfamily TAFH domain-like 2.49e-39
Family TAFH domain-like 0.00000134
Further Details:      
 
Domain Number 2 Region: 570-612
Classification Level Classification E-value
Superfamily HIT/MYND zinc finger-like 0.000000000146
Family MYND zinc finger 0.00022
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000003326
Domain Number - Region: 504-578
Classification Level Classification E-value
Superfamily CAPPD, an extracellular domain of amyloid beta A4 protein 0.00111
Family CAPPD, an extracellular domain of amyloid beta A4 protein 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000003326   Gene: ENSNLEG00000002658   Transcript: ENSNLET00000003492
Sequence length 662
Comment pep:known_by_projection supercontig:Nleu1.0:GL397315.1:6137632:6280748:-1 gene:ENSNLEG00000002658 transcript:ENSNLET00000003492 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCHPDKAFTSDKLQCVFNEYKAAVWVPPRPRPLSRAPLPEAGGENLHLKISRVRKRNLPF
VVRGEEEASPGLDAISHHLCYPDRTHRDRTEKHSTMPDSPVDVKTQSRLTPPTMPPPPTT
QGAPRTSSFTPTTLTNGTSHSPTALNGAPSPPNGFSNGPSSSSSSSLANQQLPPACGARQ
LSKLKRFLTTLQQFGNDISPEIGERVRTLVLGLVNSTLTIEEFHSKLQEATNFPLRPFVI
PFLKANLPLLQRELLHCARLAKQNPAQYLAQHEQLLLDASTTSPVDSSELLLDVNENGKR
RTPDRTKENGFDREPLHSEHPSKRPCTISPGQRYSPNNGLSYQPNGLPHPTPPPPQHYRL
DDMAIAHHYRDSYRHPSHRDLRDRNRPMGLHGTRQEEMIDHRLTDREWAEEWKHLDHLLN
CIMDMVEKTRRSLTVLRRCQEADREELNYWIRRYSDAEDLKKGGGSSSSHSRQQSPVNPD
PVALDAHREFLHRPASGYVPEEIWKKAEEAVNEVKRQAMTELQKAVSEAERKAHDMITTE
RAKMERTVAEAKRQAAEDALAVINQQEDSSESCWNCGRKASETCSGCNTARYCGSFCQHK
DWEKHHHICGQTLQAQQQGDTPAVSSSVTPNSGAGSPMDTPPAATPRSTTPGTPSTIETT
PR
Download sequence
Identical sequences ENSNLEP00000003334 ENSNLEP00000003326

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]