SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000003352 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000003352
Domain Number 1 Region: 2-40
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000212
Family C1 set domains (antibody constant domain-like) 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000003352   Gene: ENSNLEG00000002760   Transcript: ENSNLET00000003518
Sequence length 128
Comment pep:novel supercontig:Nleu1.0:GL397320.1:3099822:3132795:-1 gene:ENSNLEG00000002760 transcript:ENSNLET00000003518 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKTNDTYMKFSWLTVPEKSLDKEHRCIVRHENNKNGVDQEIIFPPIKTDVITMDPKDSYS
KDANVFANPSPINVSYSVKRTYALLLQLTNTSAYYMYLLLLVKSVVYFAIIAFCLLRRTA
VCCNGERS
Download sequence
Identical sequences ENSNLEP00000003352

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]