SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000003372 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000003372
Domain Number 1 Region: 141-235
Classification Level Classification E-value
Superfamily Immunoglobulin 7.62e-22
Family C1 set domains (antibody constant domain-like) 0.00000355
Further Details:      
 
Domain Number 2 Region: 28-137
Classification Level Classification E-value
Superfamily Immunoglobulin 9.59e-20
Family V set domains (antibody variable domain-like) 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000003372   Gene: ENSNLEG00000002778   Transcript: ENSNLET00000003538
Sequence length 338
Comment pep:novel supercontig:Nleu1.0:GL397320.1:3100353:3207233:-1 gene:ENSNLEG00000002778 transcript:ENSNLET00000003538 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLALALLLAFLPPASQKSFNLEGRTKSVTGPTGSLAVITCDLPVENAVYIHWYLHQEGK
APRRLLYYVFSTSKVVLESGISLGKYHTYASTRRSFKFILENLIEHDSGVYYCATWDNYY
KKLFGSGTTLIVTDKHLDADVSPKPTIFLPSIAETKLHKAGTYLCLLEKFFPDVIEIHWQ
EKKSNTILGSQEGNTMKTNDTYMKFSWLTVPEKSLDKEHRCIVRHENNKNGVDQEIIFPP
IKTDVTTVDPKDSYSKDANDVTTVDPKDSYSKDANDVITMDPKDSYSKDANDALLLQLTN
TSAYYMYLLLLVKSVVYFAIIAFCLLRRTAVCCNGERS
Download sequence
Identical sequences ENSNLEP00000003372 ENSNLEP00000003372

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]