SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000003374 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000003374
Domain Number 1 Region: 4-448,560-612
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.12e-81
Family GDI-like N domain 0.000000000000859
Further Details:      
 
Domain Number 2 Region: 448-559
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 7.45e-42
Family GDI-like 0.00000116
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000003374   Gene: ENSNLEG00000002762   Transcript: ENSNLET00000003540
Sequence length 653
Comment pep:known_by_projection supercontig:Nleu1.0:GL397321.1:9643715:9841896:-1 gene:ENSNLEG00000002762 transcript:ENSNLET00000003540 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADTLPSEFDVIVIGTGLPESIVAAACSRSGRRVLHVDSRSYYGGNWASFSFSGLLSWLK
EYQENSDIVNDSPVWQDQILENEEAIALSRKDKTIQHVEVFCYASQDLHEDVEEAGALQK
NHALVTSANSTEAADSAFLPTEHEPLSTMSCEMLTEQTPSSGPENALEVNGAEVTGEKEN
HCDDKTCVPSTSAEDMSENVPIAEDTTEQPKKNRITYSQIIKEGRRFNIDLVSKLLYSRG
LLIDLLIKSNVSRYAEFKNITRILAFREGQVEQVPCSRADVFNSKQLTMVEKRMLMKFLT
FCMEYEKYPDEYKGYEEITFYEYLKTQKLTPNLQYIVLHSIAMTSETASSTIDGLKATKN
FLHCLGRYGNTPFLFPLYGQGELPQCFCRMCAVFGGIYCLRHSVQCLVVDKESRKCKAII
DQFGQRIISEHFLVEDSYFSENMYSRVQYRQISRAVLITDRSVLKTDSDQQISILTVPAE
EPGTFAVRVIELCSSTMTCMKGTYLVHLTCTSSKTAREDLEPVVQKLFIPYTEMEIENEQ
VEKPRILWALYFNMRDSSDISRSCYNDLPSNVYVCSGPDCGLGNDNAVKQAETLFQEICP
NEDFCPPPPNPEDIVLDGDSLQPEASESSAIPEANSETVKESTNLGNLEESSE
Download sequence
Identical sequences G1QR06
XP_003269065.1.23891 ENSNLEP00000003374 ENSNLEP00000003374

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]