SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000003378 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000003378
Domain Number 1 Region: 27-118
Classification Level Classification E-value
Superfamily Immunoglobulin 8.11e-17
Family V set domains (antibody variable domain-like) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000003378   Gene: ENSNLEG00000026881   Transcript: ENSNLET00000003544
Sequence length 200
Comment pep:novel supercontig:Nleu1.0:GL397320.1:3219014:3230543:-1 gene:ENSNLEG00000026881 transcript:ENSNLET00000003544 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRWALAVLLAFLSPASQKSSNLEGRTKSVTRPTGSSAEITCDLTVTDTFYIHWYLHQEGK
APQRLLYYDVSDSRDVLESGLSQVKYYTHTPRRWSWILILRNLIENDSGVYYCASWGSHS
DSDLPYTTQKICLVAASGTQDRAAASHFLPPNLLYSEQEKDSLTPDLPPNIILSWQQLHP
VRYLSHRTFLKTKLPSPGLS
Download sequence
Identical sequences ENSNLEP00000003378

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]