SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000003491 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000003491
Domain Number 1 Region: 62-197
Classification Level Classification E-value
Superfamily TRAF domain-like 4.45e-24
Family SIAH, seven in absentia homolog 0.0052
Further Details:      
 
Domain Number 2 Region: 230-329
Classification Level Classification E-value
Superfamily PDZ domain-like 3.94e-23
Family PDZ domain 0.0000245
Further Details:      
 
Domain Number 3 Region: 398-489
Classification Level Classification E-value
Superfamily PDZ domain-like 9.86e-22
Family PDZ domain 0.00000875
Further Details:      
 
Domain Number 4 Region: 1-67
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000042
Family RING finger domain, C3HC4 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000003491   Gene: ENSNLEG00000002833   Transcript: ENSNLET00000003664
Sequence length 1051
Comment pep:known_by_projection supercontig:Nleu1.0:GL397298.1:5451535:5719692:-1 gene:ENSNLEG00000002833 transcript:ENSNLET00000003664 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LKCALCHKVLEDPLTTPCGHVFCAGCVLPWVVQEGSCPARCRGRLSAKELNHVLPLKRLI
LKLDIKCAYAARGCGRVVKLQQLPEHLERCDFAPARCRHAGCGQVLLRRDVEAHMRDACD
ARPVGRCQEGCGLPLTHGEQRAGGHCCARALRAHNGALQARLGALHKALKKEALRAGKRE
KSLVAQLAAAQLELQMTALRYQKKFTEYSARLDSLSRCVAAPPGGKGEETKSLTLVLHRD
SGSLGFNIIGGRPSVDNHDGSSSEGIFVSKIVDSGPAAKEGGLQIHDRIIEVNGKDLSRA
THDQAVEAFKTAKEPIVVQVLRRTPRTKMFTPPSESQLVDTGTQTDITFEHIMALTKMSS
PSPPVLDPYLLPEEHPSAHEYYDPNDYIGDIHQEMDREELELEEVDLYRMNSQDKLGLTV
CYRTDDEDDIGIYISEIDPNSIAAKDGRIREGDRIIQINGIEVQNREEAVALLTSEENKN
FSLLIARPELQLDEGWMDDDRNDFLDDLHMDMLEEQHHQAMQFTASVLQQKKHDEDGGTT
DTATILSNQHEKDSGVGRTDESTRNDESSEQENNGDDATASSNPLAGQRKLTCSQDTLGS
GDLPFSNESFISADCTDADYLGIPVDECERFRELLELKCQVKSATPYGLYYPSGPLDAGK
SDPESVDKELELLNEELRSIELECLSIVRAHKMQQLKEQYRESWMLHNSGFRNYNTSIDV
RRHELSDITELPEKSDKDSSSAYNTGESCRSTPLTLEISPDNSLRRAAEGISCPSSEGAV
GTTEAYGPASKNLLSITEDPEVGTPTYSPSLKELDPNQPLESKERRASDGSRSPTPSQKL
GSAYLPSYHHSPYKHAHIPAHAQHYQSYMQLIQQKSAVEYAQSQMSLVSMCKDLSSPTPS
EPRMEWKVKIRSDGTRYITKRPVRDRLLRERALKIREERSGMTTDDDAVSEMKMGRYWSK
EERKQHLVKAKEQRRRREFMMQSRLDCLKEQQAADDRKEMNILELSHKKMMKKRNKKIFD
NWMTIQELLTHGTKSPDGTRVYNSFLSVTTV
Download sequence
Identical sequences ENSNLEP00000003491 ENSNLEP00000003491

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]