SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000003533 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000003533
Domain Number 1 Region: 124-295
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.42e-50
Family G proteins 0.0000000227
Further Details:      
 
Domain Number 2 Region: 9-128
Classification Level Classification E-value
Superfamily Transducin (alpha subunit), insertion domain 1.06e-43
Family Transducin (alpha subunit), insertion domain 0.000000359
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000003533   Gene: ENSNLEG00000002860   Transcript: ENSNLET00000003706
Sequence length 301
Comment pep:known_by_projection supercontig:Nleu1.0:GL397309.1:9001563:9337743:-1 gene:ENSNLEG00000002860 transcript:ENSNLET00000003706 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRIIHGSGYSDEDKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYKYEHNKAHAQLVREVDV
EKVSAFENPYVDAIKSLWNDPGIQECYDRRREYQLSDSTKYYLNDLDRVADPAYLPTQQD
VLRVRVPTTGIIEYPFDLQSVIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQV
LVESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMYSHLVDYFPEYDGP
QRDAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYNL
V
Download sequence
Identical sequences A0A0D9R5U9 A0A1U7TCY7 A0A2K6SNQ6 L5LK13 M3YMA2 W5PS49
ENSNLEP00000003533 ENSOARP00000013278 ENSFCAP00000007855 ENSFCAP00000020206 ENSMPUP00000012459 ENSMPUP00000012459 NP_001003249.1.84170 XP_004093297.2.23891 XP_005868360.1.60319 XP_005969823.1.78601 XP_006086887.1.53796 XP_006769081.1.95426 XP_006918517.1.64745 XP_007077576.1.5354 XP_007113194.1.24612 XP_007182359.1.59432 XP_008054263.1.4292 XP_008566723.1.73410 XP_008962111.1.60992 XP_010362757.1.97406 XP_011373796.1.92234 XP_011810029.1.43180 XP_011839469.1.47321 XP_012374706.1.11602 XP_012901124.1.14098 XP_014928096.1.86478 XP_016078358.1.3490 XP_016816478.1.37143 XP_016870117.1.92137 XP_017748206.1.44346 XP_017748207.1.44346 XP_019592222.1.88060 XP_021545040.1.83697

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]