SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000003540 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000003540
Domain Number 1 Region: 23-128
Classification Level Classification E-value
Superfamily Immunoglobulin 5.8e-18
Family V set domains (antibody variable domain-like) 0.00000201
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000003540   Gene: ENSNLEG00000002889   Transcript: ENSNLET00000003713
Sequence length 235
Comment pep:known_by_projection supercontig:Nleu1.0:GL397319.1:14060916:14068034:-1 gene:ENSNLEG00000002889 transcript:ENSNLET00000003713 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLPVTALLLPLALMLHAARPSQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQP
RGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSN
SIMYFSHFVPVFLPEKPTTTPAPRPPTPAATTASQPLSLRPEACRPAAGGAVHTRGLDFA
CGIYIWAPLAGTCGVLLLSLVITLYCNHRNRRRVCKCPRPVVKSGGKPSLSERYV
Download sequence
Identical sequences G1QRH2
XP_003268831.1.23891 ENSNLEP00000003540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]